KEGG   Mus musculus (house mouse): 14733
Entry
14733             CDS       T01002                                 
Symbol
Gpc1, AI462976
Name
(RefSeq) glypican 1
  KO
K08107  glypican 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    14733 (Gpc1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14733 (Gpc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    14733 (Gpc1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14733 (Gpc1)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   14733 (Gpc1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  14733 (Gpc1)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 14733
NCBI-ProteinID: NP_057905
MGI: 1194891
Ensembl: ENSMUSG00000034220
UniProt: Q9QZF2 Q3U379
LinkDB
Position
1:92759367..92787933
AA seq 557 aa
MELRTRGWWLLCAAAALVVCARGDPASKSRSCSEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANHSRMELESALHDSSRALQATLATQLHGIDDHFQRLLNDSER
TLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVP
LAPECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLIT
DKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQACGNPKVNPHGSGPEEKRRR
GKLALQEKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSPASDDRCWNGISK
GRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRGAYGGNDVDFQDA
SDDGSGSGSGGGCPDDTCGRRVSKKSSSSRTPLTHALPGLSEQEGQKTSAATCPEPHSFF
LLFLVTLVLAAARPRWR
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggaactccggacccgaggctggtggctgctgtgcgcggccgccgcgctggtcgtctgc
gcccgcggggaccccgccagcaagagccggagctgcagcgaagtccgccagatctacggg
gctaagggctttagcctgagcgatgtgcctcaggcagagatctcgggtgagcacctgcgg
atctgcccccagggctacacttgctgtactagtgagatggaggagaatttggccaaccac
agccgaatggagctggagagcgcactccatgacagcagccgcgccctgcaggccacactg
gccacccagctgcatggcatcgatgaccacttccagcgcctgctgaatgactcggagcgc
acactgcaggaggctttccctggggcctttggggacctgtatacgcagaacactcgtgcc
ttccgggacctatatgctgagctgcgcctctactaccgtggggccaacctgcaccttgag
gagacgctggccgagttctgggcacggctgctggagcgcctcttcaagcagctgcacccc
cagctgctgcctgatgactacctggactgcctgggcaagcaggcggaggcactgcggccg
tttggagatgcccctcgagaactgcgcctgcgggccacccgtgcctttgtggctgcacgt
tcctttgtgcagggcctgggtgtggccagtgatgtagtccggaaggtggcccaggtacct
ctggccccagaatgttctcgggccatcatgaagttggtctactgtgctcattgccgggga
gtcccgggcgcccggccctgccccgactattgccgaaatgtgctcaaaggctgccttgcc
aaccaggccgacctggatgccgagtggaggaacctcctggactccatggtgctcatcact
gacaagttctggggcccgtcgggtgcggagagtgtcattggcggtgtgcacgtgtggctg
gcggaggccatcaacgccctccaggacaacaaggacacactcacagctaaggtcatccag
gcctgtggaaaccccaaggtcaatccccacggctctgggcccgaggagaagcgtcgccgt
ggcaaattggcactgcaggagaagccctccacaggtactctggaaaaactggtctctgag
gccaaggcccagctccgagacattcaggacttctggatcagcctcccagggacactgtgc
agtgagaagatggccatgagtcctgccagtgacgaccgctgctggaatggaatttccaag
ggccggtacctaccagaggtgatgggtgacgggctggccaaccagatcaacaaccctgag
gtggaagtggacatcaccaagccagacatgaccatccgccagcagattatgcagctcaag
atcatgaccaaccgtttacgtggcgcctatggcggcaacgacgtggacttccaggatgct
agtgatgacggcagtggctccggcagcggtggcggatgcccagatgacacctgtggccgg
agggtcagcaagaagagttccagctcccggacccccttgacccatgccctccccggcctg
tcagaacaggagggacagaagacctcagctgccacctgcccagagccccacagcttcttc
ctgctcttcctcgtcaccttggtccttgcggcagccaggcccaggtggcggtaa

KEGG   Mus musculus (house mouse): 15529
Entry
15529             CDS       T01002                                 
Symbol
Sdc2, 4833414L08Rik, AA960457, Hspg1, Synd2, syndecan-2
Name
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu05144  Malaria
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15529 (Sdc2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15529 (Sdc2)
  09174 Infectious disease: parasitic
   05144 Malaria
    15529 (Sdc2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    15529 (Sdc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    15529 (Sdc2)
   00535 Proteoglycans [BR:mmu00535]
    15529 (Sdc2)
CD molecules [BR:mmu04090]
 Proteins
  15529 (Sdc2)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   15529 (Sdc2)
SSDB
Motif
Pfam: Syndecan Glycophorin_A Peptidase_M50 DUF2721 Cadherin_C_2 MtrF
Other DBs
NCBI-GeneID: 15529
NCBI-ProteinID: NP_032330
MGI: 1349165
Ensembl: ENSMUSG00000022261
UniProt: P43407
LinkDB
Position
15:32920869..33034867
AA seq 202 aa
MQRAWILLTLGLMACVSAETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGAD
EDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEE
KLGPAIKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSY
DLGERKPSSAAYQKAPTKEFYA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcagcgcgcgtggatcctgctcaccttgggcttgatggcctgtgtgtccgcagagacg
agaacagagctgacatccgataaggatatgtaccttgacaatagctccattgaggaagct
tcaggagtatatcctattgatgatgatgactattcttctgcctcaggctcaggagctgat
gaagacatagagagtccagttctgacaacatcccaactgattccaagaatcccactcact
agtgctgcttcccccaaagtggaaaccatgacgttgaagacacaaagcattacacctgct
cagactgagtcacctgaagaaactgacaaggaggaagttgacatttctgaggcagaagag
aagctgggccctgctataaaaagcacagatgtgtacacggagaaacattcagacaatctg
tttaaacggacagaagttctagcagccgtcattgctggtggtgtgatcggctttctcttt
gccattttcctcatcctgctattggtgtaccgcatgcggaagaaagatgaaggaagctac
gaccttggagaacgcaaaccatccagcgcagcttaccagaaggcacccactaaggagttt
tatgcataa

KEGG   Mus musculus (house mouse): 20969
Entry
20969             CDS       T01002                                 
Symbol
Sdc1, AA408134, AA409076, CD138, Sstn, Synd, Synd1, syn-1
Name
(RefSeq) syndecan 1
  KO
K06257  syndecan 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu05144  Malaria
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    20969 (Sdc1)
   04514 Cell adhesion molecules
    20969 (Sdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    20969 (Sdc1)
  09174 Infectious disease: parasitic
   05144 Malaria
    20969 (Sdc1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    20969 (Sdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20969 (Sdc1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20969 (Sdc1)
   00535 Proteoglycans [BR:mmu00535]
    20969 (Sdc1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    20969 (Sdc1)
CD molecules [BR:mmu04090]
 Proteins
  20969 (Sdc1)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   20969 (Sdc1)
SSDB
Motif
Pfam: Syndecan Glycophorin_A Romo1
Other DBs
NCBI-GeneID: 20969
NCBI-ProteinID: NP_035649
MGI: 1349162
Ensembl: ENSMUSG00000020592
UniProt: P18828 Q3V1F2
LinkDB
Position
12:8821396..8843716
AA seq 311 aa
MRRAALWLWLCALALRLQPALPQIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQT
PSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEK
EVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPR
VEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGA
TGASQSLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGGAY
QKPTKQEEFYA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagacgcgcggcgctctggctctggctctgcgcgctggcgctgcgcctgcagcctgcc
ctcccgcaaattgtggctgtaaatgttcctcctgaagatcaggatggctctggggatgac
tctgacaacttctctggctctggcacaggtgctttgccagatactttgtcacggcagaca
ccttccacttggaaggacgtgtggctgttgacagccacgcccacagctccagagcccacc
agcagcaacaccgagactgcttttacctctgtcctgccagccggagagaagcccgaggag
ggagagcctgtgctccatgtagaagcagagcctggcttcactgctcgggacaaggaaaag
gaggtcaccaccaggcccagggagaccgtgcagctccccatcacccaacgggcctcaaca
gtcagagtcaccacagcccaggcagctgtcacatctcatccgcacgggggcatgcaacct
ggcctccatgagacctcggctcccacagcacctggtcaacctgaccatcagcctccacgt
gtggagggtggcggcacttctgtcatcaaagaggttgtcgaggatggaactgccaatcag
cttcccgcaggagagggctctggagaacaagacttcacctttgaaacatctggggagaac
acagctgtggctgccgtagagcccggcctgcggaatcagcccccggtggacgaaggagcc
acaggtgcttctcagagccttttggacaggaaggaagtgctgggaggtgtcattgccgga
ggcctagtgggcctcatctttgctgtgtgcctggtggctttcatgctgtaccggatgaag
aagaaggacgaaggcagctactccttggaggagcccaaacaagccaatggcggtgcctac
cagaaacccaccaagcaggaggagttctacgcctga

KEGG   Mus musculus (house mouse): 20971
Entry
20971             CDS       T01002                                 
Symbol
Sdc4, AA959608, AW108331, S4, Synd4, ryudocan, syndecan-4
Name
(RefSeq) syndecan 4
  KO
K16338  syndecan 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    20971 (Sdc4)
   04514 Cell adhesion molecules
    20971 (Sdc4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    20971 (Sdc4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    20971 (Sdc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    20971 (Sdc4)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   20971 (Sdc4)
SSDB
Motif
Pfam: Syndecan Glycophorin_A
Other DBs
NCBI-GeneID: 20971
NCBI-ProteinID: NP_035651
MGI: 1349164
Ensembl: ENSMUSG00000017009
UniProt: O35988 Q3U5S6
LinkDB
Position
2:complement(164266167..164285512)
AA seq 198 aa
MAPACLLAPLLLLLLGGFPLVPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFE
LSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSD
VGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcgcctgcctgcctgcttgcgccgctgctgctgctgctcctcggaggcttccccttg
gtccccggagagtcgattcgagagacagaggtcatcgacccccaggacctcctggaaggc
agatacttctctggagccctccccgacgacgaagatgctggcggctcggatgactttgag
ctctcgggttctggagatctggatgacacggaggagcccaggcccttccctgaagtgatt
gagcccttggtgccactggataaccacatccctgagaatgcacagcctggcatccgtgtc
ccctcagagcccaaggaactggaagagaatgaggtcattcctaaaagggccccctccgac
gtgggggatgacatgtccaacaaagtatccatgtccagcactgcccagggcagcaacatc
tttgagagaactgaggtcttggcagctctgatcgtgggcggcgtggtaggcatcctcttt
gccgttttcctgatcctgctgctggtgtaccgcatgaagaagaaggacgaaggcagttac
gacttgggcaagaaacccatctacaaaaaagcccccaccaatgagttctacgcatga

DBGET integrated database retrieval system