KEGG   Mus musculus (house mouse): 14934
Entry
14934             CDS       T01002                                 
Symbol
Gypa, AI853584, CD235a, GPA
Name
(RefSeq) glycophorin A
  KO
K06575  glycophorin A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04640  Hematopoietic cell lineage
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14934 (Gypa)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    14934 (Gypa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14934 (Gypa)
CD molecules [BR:mmu04090]
 Proteins
  14934 (Gypa)
SSDB
Motif
Pfam: Glycophorin_A Syndecan DUF6040 K1
Other DBs
NCBI-GeneID: 14934
NCBI-ProteinID: NP_034499
MGI: 95880
Ensembl: ENSMUSG00000051839
UniProt: P14220 Q3TZH8 Q3TRN7
LinkDB
Position
8:81220674..81237414
AA seq 168 aa
MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHS
ATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALVMILIILGVMAGI
IGTILLISYCISRMTKKSSVDIQSPEGGDNSVPLSSIEQTPNEESSNV
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaccgagagcacagctgctgtgacaacatcaggtcattctcttacaaccaccttccat
ataccttcaagtcaacattaccaagaagagcattcaccatcattgtcaggatcagattct
cttcttcaaataaccactcctgtggtggcttcaactgtaggtaacccaaatcagcattca
gcaacaatgtcaacaccagctattcatgtctcaacttatcacacggcccctactgaagtg
tctgctgcgtttgaagaacagcctgtctcaccacacattggaggaatgccgtcaccaatt
caacacgattttcctgcactagtgatgatactcataattttgggcgtgatggcagggatt
atcggaactatccttcttatctcttactgtatcagccgaatgacaaagaaaagttcagtt
gacatccaatctcctgagggtggtgacaacagtgtgcctttgagttctattgagcagact
cctaatgaagagtcctccaatgtttga

DBGET integrated database retrieval system