KEGG   Mus musculus (house mouse): 15953
Entry
15953             CDS       T01002                                 
Symbol
Ifi47, 47kDa, IRG-47, Ifggc1, Igrd, Iigp4, Iipg4, Irgd
Name
(RefSeq) interferon gamma inducible protein 47
  KO
K17072  interferon gamma inducible protein 47
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    15953 (Ifi47)
SSDB
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N RsgA_GTPase AAA_22 FeoB_N Roc ABC_tran AAA_16 AAA_29 Sigma54_activat AAA_21 AIG1 Sigma54_activ_2
Other DBs
NCBI-GeneID: 15953
NCBI-ProteinID: NP_001258605
MGI: 99448
Ensembl: ENSMUSG00000078920
UniProt: Q61635
LinkDB
Position
11:48967414..48987814
AA seq 420 aa
MDQFISAFLKGASENSFQQLAKEFLPQYSALISKAGGMLSPETLTGIHKALQEGNLSDVM
IQIQKAISAAENAILEVAVIGQSGTGKSSFINALRGLGHEADESADVGTVETTMCKTPYQ
HPKYPKVIFWDLPGTGTPNFHADAYLDQVGFANYDFFIIISSSRFSLNDALLAQKIKDAG
KKFYFVRTKVDSDLYNEQKAKPIAFKKEKVLQQIRDYCVTNLIKTGVTEPCIFLISNLDL
GAFDFPKLEETLLKELPGHKRHMFALLLPNISDASIELKKHFLREKIWLEALKSAAVSFI
PFMTFFKGFDLPEQEQCLKDYRSYFGLDDQSIKEIAEKLGAPLADIKGELKCLDFWSLVK
DNSIIAQATSAAEAFCAVKGGPESSAFQALKVYYRRTQFLNIVVDDAKHLLRKIETVNVA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggatcagttcatctcagccttcctgaagggtgcttcagaaaatagtttccaacaatta
gctaaggagtttctgcctcagtactctgcattaatcagtaaggcaggaggcatgctctct
ccagaaaccctcactggtattcacaaagccctccaggagggaaatctctctgatgtcatg
atccagattcagaaagcaattagtgctgcagagaatgctatcctggaggtggctgtgatc
gggcagtctgggactggcaagtccagttttataaatgcccttcgagggctgggccacgaa
gcagatgaatccgctgatgttgggactgtggagaccactatgtgtaaaaccccctatcaa
catccaaaatatcccaaagtgatcttctgggacctgcctgggactgggacacccaatttc
cacgcagacgcttatctagaccaagtgggatttgccaactatgacttcttcatcatcatt
tcttcttcccgcttcagcctcaatgatgctctcctggctcagaaaataaaggatgctggg
aagaagttctactttgttagaaccaaggtggatagtgacttatataatgaacagaaagcc
aaacccatagctttcaagaaggagaaagtccttcagcagattcgagactactgtgtgact
aatctcatcaaaactggggtgactgaaccatgcatcttcctgatctccaacttggatctg
ggtgcgtttgatttccccaagctggaggagactctgctaaaggagctccctgggcacaag
cgtcatatgtttgccctgctcttgcccaatatctcggatgcttccattgagctaaagaaa
cattttcttcgggagaagatctggctggaggccttgaagtcagcagctgtgagcttcatc
cccttcatgactttctttaagggctttgatttgcctgaacaagaacagtgcttgaaggat
taccgaagctattttggcttggatgatcaatcgattaaagagattgctgaaaaattgggc
gcacccttggcagacatcaagggggaacttaagtgcttggatttctggtcccttgtaaag
gataacagcataatagcgcaagctacgagtgctgctgaagctttttgtgctgtgaaagga
ggccctgaatcttctgccttccaggctttaaaagtctattataggcgcacacagttcctt
aacatagtggttgacgatgctaaacatctcttgagaaagatagaaacagtaaatgttgcc
tag

KEGG   Mus musculus (house mouse): 432555
Entry
432555            CDS       T01002                                 
Symbol
Gm5431, EG432555, Irgb9b8
Name
(RefSeq) predicted gene 5431
  KO
K17072  interferon gamma inducible protein 47
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    432555 (Gm5431)
SSDB
Motif
Pfam: IIGP Dynamin_N MMR_HSR1 AAA_16 DUF3867 RsgA_GTPase FeoB_N ABC_tran Sigma54_activ_2 AAA_29 Sigma54_activat T2SSE AIG1 AAA_22 FtsK_SpoIIIE Roc KAP_NTPase GP3_package
Other DBs
NCBI-GeneID: 432555
NCBI-ProteinID: NP_001019401
MGI: 3645205
Ensembl: ENSMUSG00000058163
UniProt: Q3TMS7 A6PWD6
LinkDB
Position
11:complement(48778249..48792979)
AA seq 566 aa
MLKQKIWKESIMPRAWATIPSRGLTQKDMEMLQQTLNDYRSSFGLDEASLENIAEDLNVT
LEELKANIKSPHLLSDEPDTSLTEKLLKYIGNPYFSKVFHLQNYFIDTVASDVKIILSKE
ELFTEQHPPLHTATCQPSSSRPSPLMAQLLVISFENFFKNFKKESKILSEETITLIESHL
EDKNLQGALSEISHALSNIDKAPLNIAVTGETGTGKSSFINALRGVRGEEEGAAPTGVVE
TTMKRTPYPHPKLPNVTIWDLPGIGSTNFQPQNYLTEMKFGEYDFFIIISATRFKEIDAH
LAKAIAKMNTKFYFVRTKIDQDVSNEQRSKPKSFNRDSVLKKIRDDCSGHLQKVLSSQPP
VFLVSNFDVSDFDFPKLENTLLRELPAHKRHLFMMSLHSVTETAIDRKRDFLRQRIWLEA
LKAGVWTTIPLGGLVRDKMQKLEETLTLYRSYFGLDEASLENIAKDFNVSVNEIKAHLRS
LQLLTKNNDMSFKEKLLKYIEYISCVTGGPLASGLYFRKTYYWQSLFIDTVASDAKSLLN
KEEFLSEKPGSCLSDLPEYWETGMEL
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgctgaaacaaaagatctggaaggaatccataatgccaagagcatgggctaccatacca
tcccggggactgacccaaaaggacatggagatgttgcaacagactttgaatgactataga
tcttcctttggcctggatgaggcatcactggaaaacatcgctgaggatttgaacgtgaca
ctggaggagctcaaggcaaacattaagtctccacatttgctctcagatgagccagataca
tccttaacagagaaactattgaagtacattggaaatccttacttttcaaaggttttccac
ttgcaaaattatttcattgacacggttgcaagcgatgttaaaattatcctcagtaaagaa
gagcttttcacagagcagcatcctccactgcacacagctacatgccagccttcctctagc
agaccctctcctttaatggctcaacttttggtgatcagctttgaaaatttttttaagaat
ttcaagaaggaaagcaaaatcctctctgaggaaaccatcaccttgattgaatcccatctg
gaggataagaaccttcagggggcattgtctgaaattagtcatgctctgagcaacattgac
aaagccccactgaacattgctgtgactggagaaacagggacagggaaatccagcttcatc
aatgccttgaggggagtaaggggtgaagaagaaggtgcagcgcccactggggtggtagag
acaaccatgaagagaactccatacccacacccaaagcttcccaatgtgacaatatgggac
ctacctggcattgggtcaaccaacttccaaccacaaaactatctgacagaaatgaagttc
ggtgagtatgacttcttcattatcatctcggctacacgcttcaaagaaattgatgcacat
ctggccaaagccattgcaaagatgaacacaaagttctactttgtccgaaccaagatagat
caagatgtcagtaatgaacagaggagtaaacctaagtctttcaatagagacagtgtctta
aagaaaataagagatgactgctcaggtcatctccagaaggttctctccagtcagcctcca
gtgttcctagtctctaactttgatgtgtctgactttgacttcccaaagctggagaacacc
ctactgagggaactcccagcccacaagcgccacctcttcatgatgtccttgcacagtgtt
actgagactgccattgaccggaagagggatttcctcagacagaggatctggctggaggcc
ctgaaggctggagtatggaccaccattccacttgggggcttagtcagagataaaatgcag
aagttggaagagaccttgactctctacaggtcttactttgggctggatgaagcctcacta
gaaaatattgccaaggatttcaatgtgtctgtgaatgaaattaaggcacaccttaggtct
ctccagttgttaacaaagaacaatgacatgtccttcaaagaaaaactgttgaaatatatt
gaatatatttcctgtgttactgggggaccacttgcctcaggcctttactttagaaagact
tactactggcaaagtctcttcattgatactgtggcaagtgatgccaagtctctccttaat
aaggaagagtttttgtcagagaaaccaggatcgtgcctctctgacctccctgaatactgg
gaaacaggaatggagttgtga

DBGET integrated database retrieval system