KEGG   Mus musculus (house mouse): 16168
Entry
16168             CDS       T01002                                 
Symbol
Il15, AI503618, IL-15
Name
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04668  TNF signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16168 (Il15)
   04668 TNF signaling pathway
    16168 (Il15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16168 (Il15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16168 (Il15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16168 (Il15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16168 (Il15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16168 (Il15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16168 (Il15)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16168 (Il15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 16168
NCBI-ProteinID: NP_001241676
MGI: 103014
Ensembl: ENSMUSG00000031712
UniProt: P48346 Q3U1Z6
Structure
LinkDB
Position
8:complement(83058253..83129883)
AA seq 162 aa
MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKI
ESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANS
TLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaattttgaaaccatatatgaggaatacatccatctcgtgctacttgtgtttcctt
ctaaacagtcactttttaactgaggctggcattcatgtcttcattttgggctgtgtcagt
gtaggtctccctaaaacagaggccaactggatagatgtaagatatgacctggagaaaatt
gaaagccttattcaatctattcatattgacaccactttatacactgacagtgactttcat
cccagttgcaaagttactgcaatgaactgctttctcctggaattgcaggttattttacat
gagtacagtaacatgactcttaatgaaacagtaagaaacgtgctctaccttgcaaacagc
actctgtcttctaacaagaatgtagcagaatctggctgcaaggaatgtgaggagctggag
gagaaaaccttcacagagtttttgcaaagctttatacgcattgtccaaatgttcatcaac
acgtcctga

DBGET integrated database retrieval system