KEGG   Mus musculus (house mouse): 16182
Entry
16182             CDS       T01002                                 
Symbol
Il18r1, Il18ralpha, Il1rrp
Name
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04668  TNF signaling pathway
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    16182 (Il18r1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16182 (Il18r1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16182 (Il18r1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    16182 (Il18r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16182 (Il18r1)
   04090 CD molecules [BR:mmu04090]
    16182 (Il18r1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL1 receptor family
   16182 (Il18r1)
CD molecules [BR:mmu04090]
 Proteins
  16182 (Il18r1)
SSDB
Motif
Pfam: TIR Ig_2 TIR_2 V-set ig Ig_3 I-set Ig_6 AbiJ_NTD5
Other DBs
NCBI-GeneID: 16182
NCBI-ProteinID: NP_032391
MGI: 105383
Ensembl: ENSMUSG00000026070
UniProt: Q61098
LinkDB
Position
1:40504712..40540014
AA seq 537 aa
MHHEELILTLCILIVKSASKSCIHRSQIHVVEGEPFYLKPCGISAPVHRNETATMRWFKG
SASHEYRELNNRSSPRVTFHDHTLEFWPVEMEDEGTYISQVGNDRRNWTLNVTKRNKHSC
FSDKLVTSRDVEVNKSLHITCKNPNYEELIQDTWLYKNCKEISKTPRILKDAEFGDEGYY
SCVFSVHHNGTRYNITKTVNITVIEGRSKVTPAILGPKCEKVGVELGKDVELNCSASLNK
DDLFYWSIRKEDSSDPNVQEDRKETTTWISEGKLHASKILRFQKITENYLNVLYNCTVAN
EEAIDTKSFVLVRKEIPDIPGHVFTGGVTVLVLASVAAVCIVILCVIYKVDLVLFYRRIA
ERDETLTDGKTYDAFVSYLKECHPENKEEYTFAVETLPRVLEKQFGYKLCIFERDVVPGG
AVVEEIHSLIEKSRRLIIVLSQSYLTNGARRELESGLHEALVERKIKIILIEFTPASNIT
FLPPSLKLLKSYRVLKWRADSPSMNSRFWKNLVYLMPAKAVKPWREESEARSVLSAP
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcatcatgaagaattaatcttgacactctgcattctcattgttaaaagtgcctcaaaa
agttgtattcaccgatcacaaattcatgtggtagagggagaacctttttatctgaagcca
tgtggcatatctgcaccagtgcacaggaatgaaacagccaccatgagatggttcaaaggc
agtgcttcacatgagtatagagagctgaacaacagaagctcgcccagagtcacttttcat
gatcacaccttggaattctggccagttgagatggaggatgagggaacgtacatttctcaa
gtcggaaatgatcgtcgcaattggaccttaaatgtcaccaaaagaaacaaacacagctgt
ttctctgacaagctcgtgacaagcagagatgttgaagttaacaaatctctgcatatcact
tgtaagaatcctaactatgaagagctgatccaggacacatggctgtataagaactgtaag
gaaatatccaaaaccccaaggatcctgaaggatgccgagtttggagatgagggctactac
tcctgcgtgttttctgtccaccataatgggacacggtacaacatcaccaagactgtcaat
ataacagttattgaaggaaggagtaaagtaactccagctattttaggaccaaagtgtgag
aaggttggtgtagaactaggaaaggatgtggagttgaactgcagtgcttcattgaataaa
gacgatctgttttattggagcatcaggaaagaggacagctcagaccctaatgtgcaagaa
gacaggaaggagacgacaacatggatttctgaaggcaaactgcatgcttcaaaaatactg
agatttcagaaaattactgaaaactatctcaatgttttatataattgcaccgtggccaac
gaagaagccatagacaccaagagcttcgtcttggtgagaaaagaaatacctgatatccca
ggccatgtctttacaggaggagtaactgtgcttgttctcgcctctgtggcagcagtgtgt
atagtgattttgtgtgtcatttataaagttgacttggttctgttctataggcgcatagcg
gaaagagacgagacactaacagatggtaaaacatatgatgcctttgtgtcttacctgaaa
gagtgtcatcctgagaataaagaagagtatacttttgctgtggagacgttacccagggtc
ctggagaaacagtttgggtataagttatgcatatttgaaagagatgtggtgcctggcgga
gctgttgtcgaggagatccattcactgatagagaaaagccggaggctaatcatcgttctc
agccagagttacctgactaacggagccaggcgtgagctcgagagtggactccacgaagca
ctggtagagaggaagattaagatcatcttaattgagtttactccagccagcaacatcacc
tttctccccccgtcgctgaaactcctgaagtcctacagagttctaaaatggagggctgac
agtccctccatgaactcaaggttctggaagaatcttgtttacctgatgcccgcaaaagcc
gtcaagccatggagagaggagtcggaggcgcggtctgttctctcagcaccttga

DBGET integrated database retrieval system