KEGG   Mus musculus (mouse): 16770Help
Entry
16770             CDS       T01002                                 

Gene name
Lalba, AW208827, Lyzg
Definition
(RefSeq) lactalbumin, alpha
  KO
K00704  alpha-lactalbumin [EC:2.4.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    16770 (Lalba)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     16770 (Lalba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys
Motif
Other DBs
NCBI-GeneID: 16770
NCBI-ProteinID: NP_034809
MGI: 96742
Ensembl: ENSMUSG00000022991
UniProt: P29752 A0A077S9Z6
LinkDB All DBs
Structure
PDB: 

Position
15; 15 F1
AA seq 143 aa AA seqDB search
MMHFVPLFLVCILSLPAFQATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQA
VVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKG
IDYWKAYKPMCSEKLEQWRCEKP
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatttcgttcctttgttcctggtgtgtattttgtcgttgcctgcctttcaagcc
acagagcttacaaaatgcaaggtgtcccatgccattaaagacatagatggctatcaaggc
atctctttgcttgaatgggcctgtgttttatttcataccagtggctacgacacacaagct
gttgtcaacgacaacggcagcacagagtacggactcttccagatcagtgacagattttgg
tgtaaaagtagtgagttccccgagtcggagaacatctgtggcatctcctgtgacaagtta
ttggatgacgagttggatgatgacatagcgtgtgccaagaagatcctggctatcaaagga
atcgactactggaaagcctacaagcccatgtgctctgagaagcttgaacagtggcgttgt
gagaagccctga

DBGET integrated database retrieval system