KEGG   Mus musculus (house mouse): 16800
Entry
16800             CDS       T01002                                 
Symbol
Arhgef2, AA408978, GEF, GEF-H1, GEFH1, LFP40, Lbcl1, Lfc, P40, mKIAA0651
Name
(RefSeq) rho/rac guanine nucleotide exchange factor (GEF) 2
  KO
K12791  Rho guanine nucleotide exchange factor 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04530  Tight junction
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    16800 (Arhgef2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16800 (Arhgef2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16800 (Arhgef2)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    16800 (Arhgef2)
SSDB
Motif
Pfam: PH_16 RhoGEF PH C1_1 C1_2 Crescentin Prok-RING_1 TrbK zinc_ribbon_9 PHD ACP_PD
Other DBs
NCBI-GeneID: 16800
NCBI-ProteinID: NP_032513
MGI: 103264
Ensembl: ENSMUSG00000028059
UniProt: Q60875
Structure
LinkDB
Position
3:88500427..88556839
AA seq 985 aa
MSRIESLTRARIDRSKEQATKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRSKTTTRERP
TSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSLNM
RNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKKQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLNQLLE
RRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQDLASAL
GLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKLIHEGCL
LWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDIANQAKGMF
LISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIETEDKAYLRRIKTKLQQ
KNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLFRLESFESLRGERLLKDAL
REVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTANGEARTFNGSIELCRADSDS
SQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQERLMEALFPEGPERWEKLSRAN
SRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRRCQRLGEERATEAGSLEARLRE
SEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRPLDPRRRSLPAGDALYLSFNPPQ
PSRGHDRLDLPVTVRSLHRPFDDREAQELGSPEDRLQDSSDPDTGSEEEVSSRLSPPHSP
RDFTRMQDIPEETESRDGEPTASES
NT seq 2958 nt   +upstreamnt  +downstreamnt
atgtctcggatcgaatccctcactcgcgcgcggatcgaccggagcaaggagcaggcaacc
aagacccgggaaaaggagaagatgaaggaagctaaagatgcccgctataccaacggccac
ctcttcaccaccatctccgtctccggcatgaccatgtgctatgcctgtaacaagagcatc
acagccaaggaagccctcatttgtcctacatgtaacgtgaccatccacaaccgctgtaaa
gacaccctggccaactgtaccaaggtcaagcagaagcaacagaaagctgcactgctgagg
aacaacactgctttgcagtctgtctcccttcgaagtaagacgaccaccagagagcggcca
acgtctgccatttacccttccgacagcttccggcagtccctcctgggttctcggcggggc
ctctcctccttatctttggccaaaagtgtttccactaccaacattgctggacatttcaat
gatgagtctcctctggggctgcgtcagatcctctcccagtccacagactccctcaacatg
cggaaccgaaccctgtccgtggaatcccttattgatgaaggtgtagaagtgttctacaat
gagctgatgagcgactttgagatggatgagaaggactttgaggcggattcttggagcctt
gccgtggacagcagcttcctgcagcagcacaaaaaggaagtgatgaagaagcaagatgtc
atctatgagctgatccagacagagctgcaccacgtgagaaccttgaagattatgacccgc
ctctttcgcactgggatgctggaagagttgcagatggagccagaagtggtccagggcctg
ttcccctgcgtggatgaactcagtgacattcacacacgtttccttaatcagcttctggaa
cggcggcgccaggctctatgtccaggcagcacccggaactttgtcatccatcgtttgggt
gacttgctcatcagtcagttctcaggttccaatgctgagcagatgcgcaagacctactca
gagttctgcagccgccacaccaaggccttaaagctctataaggagctgtatgctcgagac
aaacgcttccaacagttcatccggaaaatgacccgctcagctgtgttgaagcggcatgga
gttcaggaatgcattctcctggtgactcagcggatcaccaaataccctgtgctcatcaac
agaatcctgcagaattcccacggggttgaagaagagtaccaagacttggcgtcagcccta
ggactagtgaaggagttgttgtccaatgtggaccaggatgtgcacgagctggagaaagag
gcccgcctgcaggagatttacaaccgaatggatccccgggctcagacccccgtacctggc
aagggccccttcggccgagatgaacttttacggagaaaacttatccatgaaggctgcctg
ctctggaagacagccacaggccgcttcaaagatgtcctgttgctgctgatgacagatgtg
ctcgtgtttctccaggaaaaggaccagaaatacattttcacgtctctggacaagccctca
gtggtgtccttgcagaacctcatcgtaagagacatagccaaccaggcgaaagggatgttt
ctgattagttctggaccgcctgagatgtatgaggtgcatgcagcgtcccgagacgaccgg
actacctggatccgtgtcatccagcagagtgtgcgcctgtgcccgtccagggaggacttt
cctctgatcgagacagaggataaggcgtatctccggaggatcaagacgaaactgcagcag
aaaaaccaggcgctagtggagctgctacagaagaatgttgagctgtttgccgagatggtc
cacttccaggccttaaaggctggcttcgttggaatgcccccacccgccctgcccaggggc
cttttccgtcttgagtcctttgagtccctccgaggcgagcgcctgctaaaggatgccctc
cgtgaagtggaaggcctgaaagacctgctgttgggcccatgtgtggacctgcctatgaca
tcccgagaaccagccttacccttggactctgacagcggtagctgtcctggggtcactgcc
aatggagaggccagaaccttcaatggctccattgaactctgtagagcagactcggattcc
agccagaaggatcggaatggaaatcagttgagatcaccacaggaggaggtgttacagcca
ttgatcaatctttatggacttctacatggcctgcaggctgttgtggtccagcaggaaaga
ctgatggaagccctgttccctgagggccctgaacggtgggaaaagctatcccgagccaac
tctcgggatggtgaagctggccgggctgcggttgcttctgtaactcctgagaagcaggcc
acggagctggcactactgcagaggcaacacaccctgttgcaggaagagctgcggcgctgc
cagcggctcggggaagagcgggcaactgaagctggcagcctggaggccaggctccgagag
agcgagcaagcccgggccctgctggagcgggaggctgaagagatccgccggcagcttgca
gccttgggccaaaacgagccactcccggcagaagcgccctgggctcgcaggcctctggac
ccacggcgccgcagccttccagcgggcgacgctttatacttgagcttcaatcccccccag
cccagtcgaggccatgaccgcctggatttgcctgtgactgttcgttccctccaccgaccc
tttgatgaccgagaggcgcaagaacttggtagccccgaggatcgactacaggacagcagt
gaccctgatactggtagtgaggaggaagtcagtagccgcctgtctccacctcacagtcct
cgagacttcacccgaatgcaggacattcctgaagagacagaaagccgagatggggagccc
acagcttcagagagctaa

DBGET integrated database retrieval system