KEGG   Mus musculus (house mouse): 17022
Entry
17022             CDS       T01002                                 
Symbol
Lum, Ldc, SLRR2D
Name
(RefSeq) lumican
  KO
K08122  lumican
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    17022 (Lum)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    17022 (Lum)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    17022 (Lum)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRRNT LRR_9 LRR_5
Other DBs
NCBI-GeneID: 17022
NCBI-ProteinID: NP_032550
MGI: 109347
Ensembl: ENSMUSG00000036446
UniProt: P51885
LinkDB
Position
10:97401363..97408565
AA seq 338 aa
MNVCAFSLALALVGSVSGQYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKK
LHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASL
KGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNE
LADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGP
LSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaatgtatgtgcgttctctcttgccttggcattagtcggtagtgtcagtggccaatac
tacgattatgacatccctctcttcatgtatgggcaaatatcacccaactgtgcaccagaa
tgtaactgcccccacagctacccaactgccatgtactgtgatgacctcaagttgaagagt
gtgccaatggttcctcctggcatcaagtacctttacctgaggaataaccaaatcgaccat
attgatgagaaggcctttgagaacgtcacagacctgcagtggctcattcttgaccacaac
cttctagaaaactccaagatcaaaggaaaggttttctctaagctgaaacaactgaagaaa
ctgcatataaactacaacaacctgaccgagtccgtcggtccacttccaaagtccctgcaa
gacctacagctgaccaataataaaatcagcaagctcggctccttcgacgggctggtcaac
ttgaccttcatttatcttcaacacaaccagctcaaagaggatgctgtctcggcttctctg
aaaggtctcaaatcactagagtacctggatttgagcttcaatcagatgagcaagctgcct
gctggtctacctacatctcttctaactctctacctagacaataataagatcagcaacatt
ccggatgagtacttcaagcgcttcactgggctgcaatacctgcgtttatctcacaatgaa
ctggctgatagtggggtacctggaaactcgtttaatatatcatccttgctcgagcttgat
ctctcctataataagcttaagagtataccaacagttaatgaaaatcttgaaaattattac
ctggaggtcaatgaacttgaaaagtttgatgtgaagagcttctgtaagatcctgggacca
ctgtcttactccaagatcaagcatctgcgcttggatggcaatcctctcactcagagcagt
ctgcctcctgacatgtatgagtgtctacgtgtagcaaatgaaatcaccgttaactaa

DBGET integrated database retrieval system