KEGG   Mus musculus (house mouse): 17222
Entry
17222             CDS       T01002                                 
Symbol
Anapc1, 2610021O03Rik, AI047775, AI853536, AW547281, Apc1, Mcpr, tsg24
Name
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    17222 (Anapc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17222 (Anapc1)
   04114 Oocyte meiosis
    17222 (Anapc1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17222 (Anapc1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17222 (Anapc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    17222 (Anapc1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17222 (Anapc1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     17222 (Anapc1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    17222 (Anapc1)
SSDB
Motif
Pfam: Apc1_MidN Apc1_N APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 17222
NCBI-ProteinID: NP_032595
MGI: 103097
Ensembl: ENSMUSG00000014355
UniProt: P53995
LinkDB
Position
2:complement(128452003..128529558)
AA seq 1944 aa
MSNFSEERATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGDAADYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
STVQQALWCDFIISQDKSEKIYKSHELEKCICILQSSCMNMHSIDGKDYIASLPFQVANV
WATKYGLLFERCSSSHEVPPSLPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DPAVKIVFLNIDPSIVMTYDAVQNVHSVWTLRRVKPEEENAVLKFPEQAGTLQNATTSSS
LTAHLRSLSKGESPVASPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGAQRFNLSSHSQSPKRHSISHSPSGSFNDSFLAPETEPIVPELCIDHLWTETLPNI
REKNSQASKVFITTDLCGQKFLCFLVEAQLQLRCVKFQESNDKTQLIFGSVTNIHAKDAA
PVEKIHTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVGTPKP
LSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELS
NGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSAPGGPSCHSEWSLF
VICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTGSDEDWEYLLNSEYHRNVE
SHLLNKSLCLTALEVSNAKDEDFSQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMG
EGICSLIDLLVQLARDLKLDSYLDHYYRDSPTLVKTTGQVCTIDQGQMGFMHHPPFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYTLGDESCVSDETCQYLSKVT
STPQKPQAEQEENRFTFRHSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIY
HCREQPDSDWSEAVCLLIGRQDLSKQACEGNLPRGKSVLSSEVSSGTEAEEEDDGMNDLN
HEVMSLIWSEDLRVQDVRRLLQSAQPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPVPKLNLTGRAPPRNTTVDLNSGNIDVPPNMASWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHVPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFSCLHKFAKDFMNYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALIEVTYKGTQWYEQTKEELMAPTLLPELHLLKQMKVKGPRYWELLIDL
SKGEQHLRSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISS
FTSDPALLSFAEYFCKPTVSMGPKQEILDLFSSILYECVAQETPEMLPAYIAMDQALRSL
KKRDMSDTSDLWQIKLILEFFSSRSHQDRQHTYPKRGLFINSEFLPVVKCTVDATLDQWL
QAGGDVCVHAYLSGQPVEKSQLNMLACFLVYHSVPAPRHLPPMGLEGSTSFAELLYRFRH
LKMPVRALLRLAPVLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctctgaagaaagggcaacgatgattgcagccggggatttgcaggaattt
gttccttttggccgagaccactgcaagcaccaccctaacgctctgaaccttcagcttcgt
cagctgcagccagcctctgagttatggtcttctgatggtgcagctggcttggtgggatct
cttcaggaggttacaatccatgagaaacagaaggaaagctggcagttaagaaaaggtgtg
agtgagattggagatgcagctgactacgatgaagagctctatgtggctgggaacatggtt
atctggagcaaagggagtaaaagccaggcactggcagtgtacaaagcgttcacagtggac
agcactgtccagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
atctataagagccatgaactagagaaatgcatatgtatattacagagttcatgtatgaac
atgcatagcatagacgggaaggattatatagcttccttaccttttcaggtggcaaatgtt
tgggccactaaatatggcttgctgtttgaacgatgcagttcttcacatgaggtacctcca
agtctacctagagaacctttgcctactatgttcagcatgctgcacccactggatgagata
actccacttgtttgtaaatccggaagtctttttggctcatcacgggtacagtatgttgta
gatccagcagtgaaaattgtgtttctgaacattgacccctccattgtcatgacctatgat
gctgttcagaatgtgcattctgtgtggactctgcggagggtaaagccagaggaagagaat
gctgttttaaagttccctgagcaggcagggaccctgcagaatgcaactactagcagctcc
ctgacagcacatctcagaagcctctccaaaggcgaatcccctgtggcttcgccgttccag
aattactcttccattcacagccagagtcgctcaacctcttcgcccagtctacactctcgg
tcgccttccatttccaacatggcggctctaagtcgtgctcactctcctgccttaggtgtg
cactctttctcaggggcgcaaagattcaacctttcaagccacagtcagtcaccaaagaga
cacagcatttctcactctccgagtggcagtttcaacgactcatttttggcaccagaaaca
gagccaattgttcctgagctgtgcattgatcacttatggactgagacacttccgaatata
agagagaaaaattctcaagcctccaaggtatttataacgactgacctgtgtggacagaag
ttcttgtgctttttagtggaggcccagcttcagttacgctgtgtaaagtttcaagagagt
aatgacaagactcagcttatctttggctctgtcaccaacatacatgcaaaagatgcagcc
ccagtggagaagatacacaccatgctggtcctagaaggcaacgggaacctggtgctgtac
acaggagtggtgcgggtggggaaagtctttatccctggacttccggctccttccctgaca
atgtccaacatgatgcctcggcccagtaccccgctcgacggtgttggtactccaaagcct
ctgagtaaattgcttggatcgatggatgaggtggttctgttgtctccagttccagaattg
agggattcttcaaaacttaatgattctctctacaatgaggattgcacattccagcagctt
ggaacttacattcattctgtgcgagaccctgttcataacagagtcactctagaactgagc
aatggctccatggttcggatcactatccctgaagtggccacctcggaattagtacaaacg
tgtctgcaagcaattaagttcatcctgccaaaagaagtagccattcaggtgctcgtcaag
tggtacaatgtgcacagtgctccaggaggacccagctgtcactcagagtggagtttattt
gtgatttgtctcttgaacatgatgggttataacacagaccgcttagcatggacccgaagt
tttgactttgaaggatcactttccccagtcattgcacccaaaaaagcaaggccttctgat
actggatctgacgaggactgggagtacttactgaactcagagtaccatcgcaatgttgag
tctcatcttttgaacaaatctctatgtttgactgctttggaagtttcaaatgcaaaggat
gaagatttttcgcagaacctcagtctggattcttctacccttctctttgctcacattcct
gcaattttctttgttcttcacctggtttatgaagagctcaagttgaatactctaatggga
gaaggaatttgttctcttatcgacctccttgttcagttggcaagggacttaaaattggac
tcttacttggaccattactatcgagattccccaactcttgtcaaaaccactggacaagta
tgcaccattgaccaaggtcagatgggatttatgcatcatcccccattttttacttctgag
ccaccaagtatttatcagtgggtgagttcatgcctgaagggtgaagggatgccaccctat
ccttaccttcctgggatttgcgagaggagcaggctagtggtcttgagcattgccctctat
acccttggtgatgagagctgtgtgtctgatgaaacttgccagtacttatccaaagtaacc
tcaactccccaaaagccacaagcagagcaagaagaaaacaggtttactttccggcattct
gcttccgtttctgttctggccgagagattagttgtctggatggccagtgtaggattcact
ttaagagatctggagactcttccctttgggattgctcttcccatcagagatgcgatttac
cactgtcgggagcagcctgattcagattggtcagaagcggtctgtctcttgattggacgt
caggatctttccaagcaggcttgtgaaggaaatttacccagaggcaaatctgtgctctca
tcagaggtgtcttcaggaactgaggcagaggaggaagatgatggcatgaatgacttgaac
catgaggttatgtcattaatatggagtgaagatttacgggtgcaggatgtgcgaaggctg
cttcaaagtgcacagcctgtccgtgtcaatgtggtgcagtacccagaactcagtgaccat
gagttcattgaagaaaaggaaaacagactgctccagttgtgtcagcgaactatggccctt
ccagtaggacgaggaatgtttaccttgttctcatatcatcctgttccaacagagccgttg
cctgttcctaaattgaatctgacagggcgagcccctccacgaaacacaactgtagatctt
aatagcggaaacatcgacgtgcctcccaacatggccagctgggccagctttcataatggt
gtggctgccggcctgaagatagccccagcctcccagatagactcagcttggatcgtttac
aacaagccaaagcatgctgagttagccaatgagtatgccggctttctcatggccctgggt
ctgaatgggcaccttaccaagctggctactctcaatatccatgactatttgaccaagggc
catgaaatgacaagcattggattgctacttggtgtttctgctgcaaagcttggcaccatg
gacatgtcaattacccggctcctcagcattcacgttcctgctctcttacccccgacatcc
acagagcttgacgtgcctcacaatgtccaagtggcggctgtggttggcattggccttgtg
tatcagggcacagctcacagacacactgcggaagtcctgttggctgaaatagggcggccc
cctggtccagaaatggaatactgcactgacagagagtcgtactccttagctgctggcctg
gccctgggcatggtttgcttggggcatggcagcaatttgattggcatgtctgatctcaat
gtgcctgagcagctgtatcagtacatggttggaggccataggcgatttcaaactggaatg
cacagggagaaacataagtctccaagttatcagatcaaagaaggagacaccataaacgtg
gatgtgacttgtcccggtgctactctggcgttggctatgatctacttaaaaaccaataac
aggtccattgctgattggctgcgtgctcctgataccatgtatttgctagactttgtgaaa
ccagaattccttttgcttaggacacttgctcggtgcttgattttgtgggatgatatctta
ccaaattccaagtgggttgacagcaatgttcctcagattataagagaaaatagtatctct
ctgagtgaaattgaattgccttgttcagaggacttgaatttggaaaccttgtcgcaagca
cacgtctacatcattgcaggagcctgcttgtctctagggtttcgatttgctggctcagaa
aacttatcagcatttagctgtctgcataaatttgcaaaagattttatgaattatttatct
gcacccaatgcttctgtaacagggccctataacctcgaaacctgcctgagtgtggtcctg
ctgtctcttgccatggtgatggctggctctgggaacctgaaggtgttgcagctctgtcgc
tttctgcacatgaagactggtggagagatgaactatggcttccacttggcccaccacatg
gccctgggccttctctttttgggaggaggaaggtactctttgagcacatccaactcatcc
attgctgcccttctctgcgccctttacccacatttcccagcccacagcactgacaaccgg
tatcatctccaggcccttcggcacctctatgtgctagctgcagaaccaaggctcctggta
cctgtggatgtggatacaaacacaccctgctatgcccttatagaagttacttacaagggc
actcagtggtatgaacagaccaaagaagaactgatggctccaacccttcttccagaactt
catcttttaaagcagatgaaagttaaagggccaagatactgggaactgctcatagattta
agcaagggagaacagcacttgaggtctattctttcgaaggatggagttttatatgtaaag
ctcagggcaggacagctctcctacaaagaagacccaatggggtggcagagtttgttggca
caaactgttgctaataggaactctgaagcccgggctttcaagcctgaaacaatttcatca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccgactgtgagc
atgggtccaaaacaggagattctggacctcttttcttcgatactttatgagtgtgttgct
caggaaaccccagagatgttgcctgcctacatagcaatggatcaggctctaagaagtctt
aaaaagagagacatgtcagacacatctgatctttggcagataaagttgatattagaattt
ttcagttcccgaagccaccaggataggcagcatacctatcctaagcgagggctcttcata
aattctgagttcctacctgtggtgaagtgcactgttgatgctaccctggaccagtggcta
caagctggcggtgatgtgtgtgtgcatgcctacctcagtgggcagcctgttgagaagtct
cagctaaacatgctggcctgcttccttgtctaccactctgtgccagcaccacgacacttg
ccccccatgggactggaagggagcacaagctttgctgaactcctctacaggttccgacac
ctgaagatgcccgtccgggctttgctaagactggctcctgtgctgcttgggaacccacag
ccgatggtcatgtga

KEGG   Mus musculus (house mouse): 217232
Entry
217232            CDS       T01002                                 
Symbol
Cdc27, AI452358, APC3, BC023187
Name
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    217232 (Cdc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    217232 (Cdc27)
   04114 Oocyte meiosis
    217232 (Cdc27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    217232 (Cdc27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    217232 (Cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    217232 (Cdc27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217232 (Cdc27)
   03036 Chromosome and associated proteins [BR:mmu03036]
    217232 (Cdc27)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     217232 (Cdc27)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     217232 (Cdc27)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    217232 (Cdc27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_16 TPR_17 TPR_19 TPR_14 TPR_9 TPR_6 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 217232
NCBI-ProteinID: NP_663411
MGI: 102685
Ensembl: ENSMUSG00000020687
UniProt: A2A6Q5 Q3TTW1 Q8BYJ1
LinkDB
Position
11:complement(104393350..104441446)
AA seq 825 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSTVI
SPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVAPTGAPTKKSVARMGQTGTKSVFSQSGNSREVTPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGLT
QPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcgctaaaccactatgct
taccgagatgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcttataaagcatatagactc
ttgaaaggacacagttgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgacgaccttgtcactgagtttggagattcagcttgcttcactctttccttg
ttgggacatgtgtattgcaagacagatcggcttgccaaagggtcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacttgtacaactctagtatctaatcacagtttatctcacagacagcctgagaca
gtccttacagaaacaccccaagacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcaactgtaatt
tcaccagataacgtcccccttggacctggtactgccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtggcacccaccggagcacctacaaaaaagtct
gttgcaagaatgggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtcacaccagtacttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcattgcctcggagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatccctaacagaaaaacaaaaagtaaaactaataaaggaggactaact
cagcccagcataaacgatagtctggaaattacaaaactggactcctctatcatttcagaa
gggaaaataaccacagtcacacctcagatccaggcatttaacctacaaaaggcagcagca
gaaggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatac
aactgcaaagaagctatcaatattttgagccatctaccttctcatcactacagtactggt
tgggtcctatgccagattggacgggcttattttgaactttcagaatacatgcaggctgaa
agaatattctcagaggttagaaggattgagagtttcagagttgaaggaatggagatctac
tctacaacactctggcatcttcagaaagacgttgctctttcagttctttcaaaagattta
acagacatggataagaattcaccagaggcctggtgtgctgcagggaattgtttcagtcta
caacgagagcatgatatagcaattaaattcttccaaagagctatccaggtcgatccaaat
tacgcttacgcctatactctattaggacatgagtttgtgttaactgaagaactagataaa
gcattagcatgttttcgaaatgctataagagtaaatcccagacattacaatgcatggtat
ggtttaggaatgatttattacaagcaagagaagttcagcctcgcagaaatgcatttccag
aaagcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcag
catgcactaaagaagtctgagaaggctttggataccctaaacaaagccattgttatcgat
cccaagaaccctctatgcaaatttcacagagcctcggttttatttgcaaatgaaaaatac
aagtctgctttacaagaactcgaggaactgaagcagattgtccccaaagagtccctcgtt
tacttcctaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaatt
gacaagcgctaccttccagatgatgaggagccaataacccaggaggaacagatcatgggg
acagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgcggcg
gaaagtgacgaattttaa

KEGG   Mus musculus (house mouse): 52206
Entry
52206             CDS       T01002                                 
Symbol
Anapc4, 2610306D21Rik, APC4, D5Ertd249e
Name
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    52206 (Anapc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    52206 (Anapc4)
   04114 Oocyte meiosis
    52206 (Anapc4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    52206 (Anapc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    52206 (Anapc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52206 (Anapc4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52206 (Anapc4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     52206 (Anapc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    52206 (Anapc4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 52206
NCBI-ProteinID: NP_077175
MGI: 1098673
Ensembl: ENSMUSG00000029176
UniProt: Q91W96 Q3TM92
LinkDB
Position
5:52991477..53024076
AA seq 807 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWSFPP
NESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTEVSSGGESEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKPTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSTHLKESPLLFPYYPRKSLHFVKRRMENVIDQCLQKP
ADVIGRSMNQAICIPLYKDARSMDCARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCI
LRRHTDISQSVSNGLIGIKFGSFTSASADKVRRSSYSCLDAQFYDDETVTVILKDSMGRE
GRDRILVQLSLSLVYNSEDSDEYEFTGSYSTRLDEQGSIIPTRTMHFEKHWRLLESMRAQ
YVAGNGLRKVSCVLSSNLRHVRVFEMDIDDEWEIDESSDDEEEAGGKPVKIKEEVLSESE
TEAHQDAAALDPDVVIKVEKLDPELDS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgctgcgctttccgacctgtttcccatcctttcgggtggtgggagagaagcagctgcca
caggagattattttcttggcctggtcccccaagcgagacctcattgctttggccaacact
acaggcgaggttttgctgcatcgccttgcaagttttcatcgagtttggagtttcccacca
aatgaaagtacaggaaaagaagtgacctgcttggcctggagaccagacggcaaacttttg
gcctttgctcttgcggataccaagaaaattattttgtgtgatgtagaaaagcctgaaagc
ttacactccttctctgtggaggctccggtctcttgtatgcattggacagaagtgactgtg
gaaagcagtgttttaacatcgttttataatgctgaggatgagtccaatcttctcttgcct
aagctgcccacattgccaaaaaattacaacagcacctcaaaaatatttagtgaagaaaat
tctgatgaaattatcaagctcttgggagatgtcaggctgaacatccttgtccttggagga
agctctggatttattgagctttatgcttatgggatgttcaaaattgcccgagtaacaggg
attgccggaacttgtattgctctgtgtttatcaagtgatttgaagtcattatcagtggtc
acagaggtttccagcggtggcgaatcagaagtttcatattttcagcttgaaaccaatctg
ctgtattccttcttacctgaagtaactcgtatggccaggaagtttactcacatttcagct
ctcttacagtatataaatttgtcactgacatgtatgtgtgaagcatgggaagaaattctg
atgcagatggactcccgtcttaccaagtttgtacaggaaaaacctacaaccacgtcagtg
caggatgagttcatgcacttgctgctgtgggggaaagccagtgctgaacttcagactctc
ctgatgaaccagttaacagtgaagggcttaaaaaagcttggccagtctatagagtcatca
tattccagtatacaaaaactggttataagtcacttacagagtggctctgagtctttactg
tatcatttgagtgaacttaaaggaatggcttcatggaaacaaaaatacgaacctctagga
ctggatgctgcaggcattgaagatgctattactgctgtgggttctttcatcctcaaagca
aacgaacttctccaagttatagacagtagtatgaaaaacttcaaggcattttttcggtgg
ctgtatgtagcaatgctgagaatgacagaggaccatgtgcttcctgagctgaacaagatg
actcagaaggatatcacatttgttgctgaattcctcactgaacatttcaatgaggctcca
gacctttataataggaaaggaaaatacttcaatgttgaaagagttggtcagtatttgaaa
gatgaagacgacgaccttgtgtcaccccctaacacagaaggaaaccagtggtatgacttc
ctccaaaacagcacccacctgaaagaaagtcctttgctgtttccttattaccctcgaaaa
tcattgcattttgtgaaaaggcggatggagaacgttattgatcagtgtttgcaaaagcca
gcagatgtaattggaagatcgatgaatcaagcaatttgcattccattatataaagatgct
aggagtatggactgtgcacgaagattgttaaaattcccatttctgtggaataataaaact
tcgaatcttcattatcttctttttactattttagaagattcggtttataaaatgtgcatc
ttaaggagacatactgatatttcccaatctgtaagtaatggactaattggtattaaattt
gggagcttcacatctgcctcagctgacaaggtcagaagaagctcttacagttgtctagac
gcccagttctatgatgatgagactgtcacggtcatcctgaaggactccatgggacgtgaa
gggagagacaggattttggttcagttgtcactgtccttggtgtataacagtgaagattct
gacgaatatgagttcactgggagttactcgacaaggcttgacgagcagggcagcattatc
cccacacgcaccatgcactttgagaaacactggaggctgctagaaagcatgagagcgcag
tatgttgctgggaacggccttcgaaaagtgtcctgtgtgttaagttcaaacctccggcat
gtgagggtgtttgaaatggacatcgatgatgagtgggagattgacgagtcttcagacgat
gaggaggaggctggcgggaagcctgtgaagatcaaggaggaagtgttgtcagagtcagag
acagaggctcaccaagacgctgctgccctagacccggacgtagtcatcaaagtggagaaa
cttgaccctgagttggactcgtga

KEGG   Mus musculus (house mouse): 52563
Entry
52563             CDS       T01002                                 
Symbol
Cdc23, 6030435O18, D18Ertd243e
Name
(RefSeq) CDC23 cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    52563 (Cdc23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    52563 (Cdc23)
   04114 Oocyte meiosis
    52563 (Cdc23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    52563 (Cdc23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    52563 (Cdc23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52563 (Cdc23)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52563 (Cdc23)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     52563 (Cdc23)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    52563 (Cdc23)
SSDB
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 TPR_17 ANAPC3 TPR_12 TPR_9 DUF772 TPR_15 TPR-S
Other DBs
NCBI-GeneID: 52563
NCBI-ProteinID: NP_848124
MGI: 1098815
Ensembl: ENSMUSG00000024370
UniProt: Q8BGZ4 A0A0R4J1W7
LinkDB
Position
18:complement(34761401..34784802)
AA seq 597 aa
MAANSSVVSVAAAATAVPGVSTVADFSDLQEIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQARGLDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTSDTPGTFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgaattcttcggtagtctcggtggcagcggccgccacggcggtgccgggcgta
tccactgtcgcggatttttcagacttgcaggaaattaaaaagcagctgctgctcatcgcg
ggcctcactcgggagcggggcctgctgcatagcagcaaatggtctgcggagttggccttc
tctctgcccgccttgcctttgtcggagctgcagccgccgccgcctctgacagaggaggac
gcgcaggatgtggatgcttacaccctggccaaggcctactttgatgttaaagagtatgac
cgggcggcacatttccttcacggctgcaatagcaagaaagcctatttcctgtacatgtat
tccagatacctgtctggagagaagaagaaggatgacgaaacagttgatagcctaggaccc
ctagagaagggacaagtcaaaaacgaggctctcagagaactgagagtggaactcagccgg
aagcaccaggctcggggacttgatggattcggcctttacctgtatggggtggtgcttcgg
aaactggacttagtgaaagaggccattgatgtgtttgtggaggctactcatgttttgcct
ttgcactggggagcctggttagagctgtgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgcctgacacctggatgaaagagttcttcttggctcacatatacacagaa
ctgcagctgatagaggaggccctgcagaagtatcagcatctcattgatgtgggcttttcc
aagagctcgtacattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctttctattttcaatgagctgaggaaacaagatccttacaggattgaaaatatg
gacacattctccaaccttctctatgtcaggagcatgaagtctgaattgagttacctggcg
cataacctctgtgaaattgataaataccgagtagaaacatgctgtgtaattggcaattat
tacagcttacgctcccagcatgagaaagcagctttgtatttccagagagccctaaagttg
aatcctaggtaccttggggcctggacactgatggggcacgagtacatggagatgaagaac
acgtctgcagctattcaggcttaccgacatgccattgaggtcaacaagagagactacaga
gcttggtatggccttgggcagacttacgaaatccttaaaatgccattttattgcctttat
tattatagacgggcccaccagcttcgtcccaatgattctcgcatgctggttgccttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcatat
gccgtgggagacgtggagaaaatggctcttgtgaagctggccaagcttcatgaacagttg
actgagtcagagcaggctgcccagtgttacatcaaatacatccaagatatctattcctgt
ggggagaccgtggagcacttggaggagagcacagccttccgatacctggcccagtactat
tttaagtgcaagctgtgggatgaagcttcaacttgtgcccaaaaatgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccgccagatcctacagctgaggaaccaaggg
gagacacccacctctgacacgccgggtacctttttcctccctgcctcactgtctgcaaac
aacactcctacacgcagagtttctccactcaacctgtcttcagtcacaccatag

KEGG   Mus musculus (house mouse): 52717
Entry
52717             CDS       T01002                                 
Symbol
Anapc16, 2310005G07Rik, APC16, D10Ertd641e
Name
(RefSeq) anaphase promoting complex subunit 16
  KO
K25229  anaphase-promoting complex subunit 16
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    52717 (Anapc16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    52717 (Anapc16)
   04114 Oocyte meiosis
    52717 (Anapc16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    52717 (Anapc16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    52717 (Anapc16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52717 (Anapc16)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52717 (Anapc16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     52717 (Anapc16)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    52717 (Anapc16)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 52717
NCBI-ProteinID: NP_079790
MGI: 1289325
Ensembl: ENSMUSG00000020107
UniProt: Q9CPV2
LinkDB
Position
10:complement(59823231..59838957)
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccgcctcctcgtcttcgtcttcagctggtggggtcagtggaagctctgtcaccgga
tctggtttcagtgtgtccgaccttgccccacctcggaaagctctgttcacctacccgaaa
ggagctggagagatgttagaagatggctccgagcgattcctctgtgagtcggtgtttagc
tatcaagtggcatccacgcttaaacaggtgaagcatgatcagcaagtcgctcggatggaa
aaactggctggtctggtggaagagctggaggccgacgagtggcggtttaaacccatcgag
cagctgctggggttcacaccctcctcgggctga

KEGG   Mus musculus (house mouse): 56317
Entry
56317             CDS       T01002                                 
Symbol
Anapc7, APC7, AW545589
Name
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    56317 (Anapc7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56317 (Anapc7)
   04114 Oocyte meiosis
    56317 (Anapc7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    56317 (Anapc7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    56317 (Anapc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56317 (Anapc7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    56317 (Anapc7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     56317 (Anapc7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    56317 (Anapc7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_16 TPR_1 TPR_14 TPR_19 ANAPC3 TPR_17 TPR_11 TPR_7 TPR_21 TPR_12 TPR_10 BTAD
Other DBs
NCBI-GeneID: 56317
NCBI-ProteinID: NP_062779
MGI: 1929711
Ensembl: ENSMUSG00000029466
UniProt: Q9WVM3
LinkDB
Position
5:122559646..122582975
AA seq 565 aa
MSVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPSQKYQLLVYHADSLFHDKEYR
NAVSKYAMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKLDKD
AIAVLDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAINTICSLEKKSLLRDNVDLL
GSLADLYFRAGDSKNSVLKFEQAQMLDPYLIRGMDVYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALAQRPDYVKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgagtgtgatagaccacgtgcgggacatggcggctgcgggactgcactccaacgtgcgg
ctcctcagcagcctgctgctcaccatgagtaacaacaaccctgagctgttttccccgtcg
cagaagtaccagctcttggtgtatcatgcagactctctgtttcacgataaggagtaccgc
aatgctgtgagtaagtacgccatggctttacagcagaagaaagccttaagtaagacttcc
aaagtgcggccttccactgggaattctgcatctactccacagagtcagtgtcttccatct
gaaattgaagtgaaatacaaaatggctgagtgttacacaatgctgaagctagacaaggat
gccattgctgtactcgatgggatcccttcaagacaaagaactcccaaaataaacatgatg
ctggcaaacctgtacaagaaggctggtcaggagcgcccatcagtcacaagctataaggag
gtcctgcggcagtgccctttggcccttgacgccattctaggtttgttatccctgtctgtg
aaaggcgcagaggtggcatcaatgacgatgaatgtgatccagactgtgcccaacttggac
tggctgtccgtgtggattaaagcgtatgcttttgtgcacaccggtgacaactcgagagca
atcaacaccatctgttcactagagaaaaaatcattactgcgagacaacgtggacctgctg
gggagcctggccgacctgtacttcagagcaggggacagcaagaactctgtcctcaagttt
gagcaggcccagatgctggatccctacttgataagagggatggatgtttacggctacctc
ctggcacgagaagggcggctggaggatgtggagaaccttggctgccgcctcttcaacatt
tctgatcagcatgcagagccctgggtggtctccggatgccacagcttctatagcaagcgc
tactctcgggccctgtacttaggtgccaaggccatccagctgaacagcaacagcgtccag
gctctgttactcaagggggcggcgcttaggaacatggggagggtccaggaagccatcata
cactttcgggaggccatcaggcttgcgccttgtcgcttggactgttacgaaggtctcata
gagtgttacttagcttctaacagcatccgagaagcaatggtgatggccaacaatgtttac
aaaactctgggtgcaaacgctcagacgcttacgctgttagccaccgtgtgtctggaagat
ccagtgacccaggagaaagccaaaactctgttagataaagccctggcgcagaggccggac
tacgtcaaggccgtggtgaagaaagcagagctgctcagcagggaacagaaatatgaagat
ggaattgctctgctgagaaatgcgctggccaaccagagtgactgtgtcctgcatcggatc
ctgggggacttcctagtagctgtgaacgagtaccaggaagcgatggaccagtacagtata
gcactgagtttggaccccaatgaccagaagtctctcgaggggatgcagaagatggagaag
gaggagagtcccacggatgccactcaggaggaagatgtggacgacatggaggggagtggg
gaagaaggggacctggagggcagcgacagtgaggcagcccagtgggcagaccaggagcag
tggttcggcatgcagtga

KEGG   Mus musculus (house mouse): 59008
Entry
59008             CDS       T01002                                 
Symbol
Anapc5, 2510006G12Rik, AA408751, AA536819, AA986414, APC5, Anpc5
Name
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04657  IL-17 signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    59008 (Anapc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    59008 (Anapc5)
   04114 Oocyte meiosis
    59008 (Anapc5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    59008 (Anapc5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    59008 (Anapc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    59008 (Anapc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59008 (Anapc5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    59008 (Anapc5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     59008 (Anapc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    59008 (Anapc5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 VP4_haemagglut TPR_7 YycI
Other DBs
NCBI-GeneID: 59008
NCBI-ProteinID: NP_067480
MGI: 1929722
Ensembl: ENSMUSG00000029472
UniProt: Q8BTZ4
LinkDB
Position
5:complement(122925522..122960402)
AA seq 740 aa
MMTNGVVHANLFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLVERRKLNQLLLPLLQGPD
ITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVV
GLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMDREDGEKQMEKEELDVS
VREEEVSCSGPLSQKQAEFFLSQQAALLKNDETKALTPASLQKELNNLLKFNPDFAEAHY
LSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSLRYAALNLAALHCRFG
HYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVLLEHSVKKAVHFGLPY
LASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRS
TMALQQAQMLLSMNSLESLNAGVQQNNTESFAVALCHLAELHAEQGCFAAAGEVLKHLKD
RFPPNSQHAQLWMLCDQKIQFDRAMNDGKFHLADSLVTGITALNGIEGVYRKAVVLQAQN
QMTEAHKLLQKLLTYCQKLKNTEMVISVLLSVAELYWRSSSPTIAMPVLLEALALSKEYR
LQYLASETVLNLAYAQLILGIPEQALTLLHMAIEPILADGAVLDKGRAMFLVSKCQVASA
ASYDPVKKAEALEAAIQNLSEAKNYFAQVDCRERIRDVAYFQARLYHALGKTQERNHCAM
IFRQLHQELPAHGVPLINHL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgatgaccaacggggtagtgcacgccaacttgtttggcatcaaggactgggtgacgccc
tataagatcgccgtcctggtgctgctcaacgagatgggccgcacgggcgagggcgccgtc
agcctcgtggagcggcggaagctcaaccagctgctcctgcccctgctgcagggcccagat
attacactgtcaaagctgtacaagctaattgaagaatcgtgtcctcagctggcaaattca
gtgcagatcagaatcaagctcatggctgaaggcgaactgaaggatatggaacaatttttt
gatgacctttcagattctttttctggaactgaaccagaggttcacaaaacgagtgtagta
ggtctgttcctgcgccacatgatcttggcctacagtaagctttctttcagtcaagtgttt
aagctgtacactgccctccagcagtacttccagaacggggagaaaaagacggtggaagat
gctgatatggaccgagaggatggagagaaacagatggagaaggaagagctcgacgtgtcc
gtgagagaagaggaagtatcttgcagtggtcctctgtcccaaaaacaagcggaatttttt
ctctctcagcaggccgctttgttgaagaatgatgagactaaagccctcaccccagcttcc
ttgcagaaggaattgaacaacctgttgaaatttaatcctgattttgctgaagctcattac
ctcagctacttaaacaacctccgtgttcaagatgttttcagctcaacacacagcctcctg
cattattttgaccgcctgattctcactggagcggagggcaaaagtaatggggaagagggt
tatggccggagcctgagatacgctgctctcaacctggctgccctgcactgccgcttcggt
cactatcaacaggcagagctcgccctgcaggaggcaattaggattgcccaggagtccaac
gatcacgtgtgtctgcagcactgtttgagctggctttatgtgctggggcagaagagagcc
gatagctatgttctgctggagcactctgtgaagaaagcagtacattttgggttaccgtac
ctcgcctccctgggaatacagtcccttgttcaacagagagcttttgctgggaagacggcc
aacaaactgatggatgccctaaaggactctgacctcctgcactggaaacacagcctgtca
gaacttatcgatatcagcattgcacagaaaacggccatctggaggctgtacggccgcagc
accatggcactgcaacaagcccagatgttgctgagcatgaacagcctggagtcgctgaat
gcgggtgtgcagcagaacaatactgagtcctttgccgtcgctctctgccatcttgcagag
ctccatgcagaacagggctgttttgcggctgctggtgaagtattaaagcacttgaaggac
cgatttccacccaacagtcagcacgcccagttatggatgctgtgtgatcaaaaaatacag
tttgacagagcaatgaatgatggcaaattccatttggctgattcacttgttacaggaatc
acagcgcttaatggcatagaaggtgtatacaggaaagcagtcgtactgcaggctcagaac
caaatgacagaggcacacaagctactacagaagttgctgacgtactgtcagaagctaaag
aacacagaaatggtcatcagtgtcctcctatcggtggcagagctgtactggcgatcttcg
tccccgaccatcgccatgcctgtgctcctggaagctctggccctctccaaagaataccga
ttgcagtacttggcctccgaaactgtgctcaacttggcttatgcccagctcatccttgga
atcccggaacaggccttaacccttctccacatggctatcgagcccatcctagccgacggg
gctgtcctggacaaaggtcgtgccatgttcttagtgtccaagtgccaagtggcttcggca
gcgtcctatgacccagtgaagaaagcggaagctctggaagctgccattcagaacctcagt
gaagccaagaactactttgcacaagtcgactgcagagagcgcatcagggatgttgcttac
ttccaggccaggctgtaccacgctcttggcaagacccaggagaggaaccattgtgccatg
atcttccggcagctgcaccaggagttgcccgcccatggggtgcccttgattaaccacctc
tag

KEGG   Mus musculus (house mouse): 66156
Entry
66156             CDS       T01002                                 
Symbol
Anapc11, 1110011I19Rik, R75218
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    66156 (Anapc11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    66156 (Anapc11)
   04114 Oocyte meiosis
    66156 (Anapc11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    66156 (Anapc11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    66156 (Anapc11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66156 (Anapc11)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66156 (Anapc11)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     66156 (Anapc11)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    66156 (Anapc11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 66156
NCBI-ProteinID: NP_001033319
MGI: 1913406
Ensembl: ENSMUSG00000025135
UniProt: Q9CPX9
LinkDB
Position
11:120489247..120499024
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaaaattaaatgttggaatggtgtggccacttggctctgggtagccaatgat
gagaactgcggcatctgcaggatggcgtttaatggctgctgtccagactgtaaggtgcct
ggtgatgactgccccctcgtgtggggacagtgctcccactgcttccacatgcactgcatc
ctcaagtggctgaatgcgcagcaggtgcagcagcactgccccatgtgtcgccaggagtgg
aagttcaaagagtga

KEGG   Mus musculus (house mouse): 66440
Entry
66440             CDS       T01002                                 
Symbol
Cdc26, 2010012C09Rik
Name
(RefSeq) cell division cycle 26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    66440 (Cdc26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    66440 (Cdc26)
   04114 Oocyte meiosis
    66440 (Cdc26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    66440 (Cdc26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    66440 (Cdc26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66440 (Cdc26)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66440 (Cdc26)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     66440 (Cdc26)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    66440 (Cdc26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 66440
NCBI-ProteinID: NP_647452
MGI: 1913690
Ensembl: ENSMUSG00000066149
UniProt: Q99JP4
LinkDB
Position
4:complement(62310581..62326862)
AA seq 85 aa
MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQM
INDRIGYKPQLKSNNRTSQFGNFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgcgacggaaaccgacccgcttagagctcaagctcgacgacattgaggagtttgag
agcattcgcaaggacctggaggcccgtaagaagcagaaggaagatgtggaaggtgtagga
accagcgatggagaaggagctgctgggctcagcagtgaccccaaaagccgggaacaaatg
attaatgatcgaattggttataaaccccaactcaagagcaacaaccgcacatctcagttt
ggaaactttgaattttag

KEGG   Mus musculus (house mouse): 68999
Entry
68999             CDS       T01002                                 
Symbol
Anapc10, 1500026N15Rik, A830003M23Rik, APC10
Name
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    68999 (Anapc10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    68999 (Anapc10)
   04114 Oocyte meiosis
    68999 (Anapc10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    68999 (Anapc10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    68999 (Anapc10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    68999 (Anapc10)
   03036 Chromosome and associated proteins [BR:mmu03036]
    68999 (Anapc10)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     68999 (Anapc10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    68999 (Anapc10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 68999
NCBI-ProteinID: NP_081180
MGI: 1916249
Ensembl: ENSMUSG00000036977
UniProt: Q8K2H6
LinkDB
Position
8:80438366..80503950
AA seq 185 aa
MTTPNKTPPGADPKQLERTATVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccgaacaagacacctcctggtgctgatcctaagcagttggagaggacagca
acagtcagggaaattgggtctcaggctgtttggtcactctcttcctgcaaaccagggttt
ggagtggatcaattacgggatgacaatctagaaacttactggcaatctgatggctctcag
cctcacttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactataagtctgatgaaagctacactccaagcaaaatctcagtcagagtaggaaat
aattttcacaaccttcaagaaatccggcaacttgaattggtggaaccaagtggctggatt
cacgttcctttaactgacaatcataagaagccaactcgcacattcatgatacagattgct
gttctagccaatcatcagaatggaagagatacccacatgagacaaattaagatatacaca
ccagtggaagagagctccattgggaaattccctagatgcacaaccattgatttcatgatg
tatcgttcaatacggtga

DBGET integrated database retrieval system