KEGG   Mus musculus (house mouse): 17387
Entry
17387             CDS       T01002                                 
Symbol
Mmp14, AI325305, MMP-X1, MT-MMP-1, MT1-MMP, sabe
Name
(RefSeq) matrix metallopeptidase 14 (membrane-inserted)
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04668  TNF signaling pathway
mmu04912  GnRH signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    17387 (Mmp14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    17387 (Mmp14)
   04928 Parathyroid hormone synthesis, secretion and action
    17387 (Mmp14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17387 (Mmp14)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     17387 (Mmp14)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   17387 (Mmp14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 Metallopep DUF4953 Reprolysin_3 HTH_17 Peptidase_M66 Reprolysin_5
Other DBs
NCBI-GeneID: 17387
NCBI-ProteinID: NP_032634
MGI: 101900
Ensembl: ENSMUSG00000000957
UniProt: P53690
LinkDB
Position
14:54669055..54679913
AA seq 582 aa
MSPAPRPSRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIL
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTT
SRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctcccgcccctcgaccctcccgcagcctcctgctccccctgctcacgcttggcacg
gcgctcgcctccctcggctgggcccaaggcagcaacttcagccccgaagcctggctgcag
cagtatggctacctacctccaggggacctgcgtacccacacacaacgctcaccccagtca
ctctcagctgccattgccgccatgcaaaagttctatggtttacaagtgacaggcaaggct
gatttggcaaccatgatggccatgaggcgccctcgctgtggtgttccggataagtttggg
actgagatcaaggccaatgttcggaggaagcgctatgccattcagggcctcaagtggcag
cataatgagatcactttctgcattcagaattacacccctaaggtgggcgagtatgccaca
ttcgaggccattcggaaggccttccgagtatgggagagtgccacgccactgcgcttccga
gaagtgccctatgcctacatccgggagggacatgagaagcaggctgacatcatgatcttg
tttgctgagggtttccacggcgacagtacaccctttgatggtgaaggagggttcctggct
catgcctacttcccaggccccaatattggaggggatacccactttgattctgccgagccc
tggactgtccaaaatgaggatctaaatgggaatgacatcttcttggtggctgtgcatgag
ttggggcatgccctaggcctggaacattccaatgatccctccgccatcatggcccccttt
taccagtggatggacacagagaacttcgtgttgcctgatgacgatcgccgtggcatccag
caactttatggaagcaagtcagggtcacccacaaagatgccccctcaacccagaactacc
tctcggccctctgtcccagataagcccaaaaaccccgcctatgggcccaacatctgtgac
gggaactttgacaccgtggccatgctccgaggagagatgtttgtcttcaaggagcgatgg
ttctggcgggtgaggaataaccaagtgatggatggatacccaatgcccattggccaattc
tggaggggcctgcctgcatccatcaatactgcctacgagaggaaggatggcaaatttgtc
ttcttcaaaggagataagcactgggtgtttgacgaagcctccctggaacccgggtacccc
aagcacattaaggagctgggccgagggctgcccacggacaagatcgatgcagctctcttc
tggatgcccaatgggaagacctacttcttccggggcaataagtactaccggttcaatgaa
gaattcagggcagtggacagcgagtaccctaaaaacatcaaagtctgggaaggaatccct
gaatctcccagggggtcattcatgggcagtgatgaagtcttcacatacttctacaaggga
aacaaatactggaagttcaacaaccagaagctgaaggtagagccagggtatcccaagtca
gctctgcgggactggatgggctgcccttcggggggccggcccgatgaggggactgaggag
gagacggaggtgatcatcattgaggtggatgaggagggcagtggagctgtgagtgcggcc
gccgtggtcctgccggtactactgctgctcctggtactggcagtgggcctcgctgtcttc
ttcttcagacgccatgggacgcccaagcgactgctttactgccagcgttcgctgctggac
aaggtctga

DBGET integrated database retrieval system