KEGG   Mus musculus (house mouse): 17392
Entry
17392             CDS       T01002                                 
Symbol
Mmp3, EMS-2, MMP-3, SL-1, SLN-1, SLN1, STR-1, Stmy1, Str1
Name
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05171  Coronavirus disease - COVID-19
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    17392 (Mmp3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    17392 (Mmp3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17392 (Mmp3)
  09162 Cancer: specific types
   05215 Prostate cancer
    17392 (Mmp3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    17392 (Mmp3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    17392 (Mmp3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    17392 (Mmp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17392 (Mmp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     17392 (Mmp3)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   17392 (Mmp3)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_4 Peptidase_M66
Other DBs
NCBI-GeneID: 17392
NCBI-ProteinID: NP_034939
MGI: 97010
Ensembl: ENSMUSG00000043613
UniProt: P28862 Q922W6 Q3UFJ0
LinkDB
Position
9:7445822..7455975
AA seq 479 aa
MKMKGLPVLLWLCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSS
LIVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRI
VNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFVPFDGPG
TVLAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLYHSAKAEALMYP
VYKSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDA
VSTLRGEVLFFKDRHFWRKSLRTPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGN
QFWAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSM
EPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaaaatgaagggtcttccggtcctgctgtggctgtgtgtggttgtgtgctcatcctac
ccattgcatgacagtgcaagggatgatgatgctggtatggagcttctgcagaaataccta
gaaaactactatggccttgcaaaagatgtgaagcaatttattaagaaaaaggacagtagt
cttattgtcaaaaaaattcaagaaatgcagaagttcctcgggttggagatgacagggaag
ctggactccaacactatggagctgatgcataagcccaggtgtggtgttcctgatgttggt
ggcttcagtaccttcccaggttcgccaaaatggaggaaatcccacatcacctacaggatt
gtgaattatacaccggatttgccaagacagagtgtggattctgccattgaaaaagctttg
aaggtctgggaggaggtgaccccactcactttctccaggatctctgaaggagaggctgac
ataatgatctcctttgcagttggagaacatggagactttgtcccttttgatgggcctgga
acagtcttggctcatgcctatgcacctggaccagggattaatggagatgctcactttgac
gatgatgaacgatggacagaggatgtcactggtaccaacctattcctggttgctgctcat
gaacttggccactccctgggactctaccactcagccaaggctgaagctctgatgtaccca
gtctacaagtcctccacagacttgtcccgtttccatctctctcaagatgatgtagatggt
attcagtccctctatggaactcccacagcatcccctgatgtcctcgtggtacccaccaag
tctaactctctggaacctgagacatcaccaatgtgcagctctactttgttctttgatgca
gtcagcaccctccggggagaagtcctgttttttaaagacaggcacttttggcgcaaatct
ctcaggactcctgagcctgaattttatttgatctcttcattttggccatctcttccatcc
aacatggatgctgcatatgaggttactaacagagacactgttttcatttttaaaggaaat
cagttctgggctatacgagggcacgaggagctagcaggttatcctaaaagcattcacacc
ctgggtctccctgcaaccgtgaagaagatcgatgctgccatttctaataaagagaaaagg
aagacctacttctttgtagaggacaaatactggaggtttgatgagaagaaacaatccatg
gagccaggatttcccaggaagatagctgaggactttccaggtgttgactcaagggtggat
gctgtctttgaagcatttgggtttctctacttcttcagtggatcttcgcagttggaattt
gacccaaatgccaaaaaagtgacccacatattgaagagcaatagctggtttaattgttaa

DBGET integrated database retrieval system