KEGG   Mus musculus (house mouse): 17528
Entry
17528             CDS       T01002                                 
Symbol
Mpz, Mpp, P-zero, P0
Name
(RefSeq) myelin protein zero
  KO
K06770  myelin protein zero
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    17528 (Mpz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    17528 (Mpz)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  P0
   17528 (Mpz)
SSDB
Motif
Pfam: Myelin-PO_C V-set Ig_2 ig Ig_3 I-set Amnionless Mucin15 SIT Protocadherin Tweety Kinocilin
Other DBs
NCBI-GeneID: 17528
NCBI-ProteinID: NP_001302428
MGI: 103177
Ensembl: ENSMUSG00000056569
UniProt: P27573 E9QK82
LinkDB
Position
1:170978282..170988699
AA seq 248 aa
MAPGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIR
YCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGL
GESRKDKK
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctcccggggctccctcctccagccccagccctatcctggctgccctgctcttctct
tctttggtgctctctccagccctggccattgtggtttacacggacagggaaatctatggt
gccgtgggctcccaggtgaccctgcactgctccttctggtccagtgaatgggtctcagat
gacatctcttttacctggcgctaccagcctgaagggggccgagatgccatttcgatcttc
cactatgccaagggacaaccttacatcgatgaggtggggaccttcaaagagcgcatccag
tgggtaggggaccctcgctggaaggatggctccattgtcatacacaacctagactacagt
gacaacggcactttcacatgtgatgtcaaaaacccaccggacatagtgggcaagacctct
caggtcacgctctatgtctttgaaaaagtgcccactaggtatggggtggtgttgggagca
gtgatcgggggcatcctcggggtggtgctgttgctgctgttgctcttctacctgattcgg
tactgctggctgcgcaggcaggctgccctgcagagaaggctcagtgccatggagaagggg
agatttcacaaatcttcgaaggactcctcgaagcgagggcggcagacgccagtgctgtat
gccatgctggaccacagccgaagcaccaaagctgccagtgagaagaaatcaaaagggctg
ggggagtctcgcaaggataagaaatag

KEGG   Mus musculus (house mouse): 68481
Entry
68481             CDS       T01002                                 
Symbol
Mpzl1, 1110007A10Rik, PZR
Name
(RefSeq) myelin protein zero-like 1
  KO
K06770  myelin protein zero
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    68481 (Mpzl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    68481 (Mpzl1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  P0
   68481 (Mpzl1)
SSDB
Motif
Pfam: V-set Ig_3 ig TraL Ig_2 I-set EphA2_TM Adeno_E3_CR2 MDM31_MDM32
Other DBs
NCBI-GeneID: 68481
NCBI-ProteinID: NP_001077366
MGI: 1915731
Ensembl: ENSMUSG00000026566
UniProt: Q3TEW6
LinkDB
Position
1:complement(165419745..165462144)
AA seq 270 aa
MAEAVGAVALIAAPARRRWLWSVLAAMLGLLTARISALEVHTPKEIFVVNGTQGKLTCTF
DSPNTTGWLTTVSWSFQPDGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASI
NIENIQAVHNGTYICDVKNPPDIVVRPGHIRLHVVEIDNLLVFLVWVVVGTVTAVVLGLT
LLISLVLVVLYRRKHSKRDYTGCSTSERLSPVKQAPRKCPSDTEGLVKSPPSAGSHQGPV
IYAQLDHSGGHHSGKINKSESVVYADIRKD
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcagaggccgtcggagccgtggcactgattgcggccccggcccgccggcgctggctg
tggtcggtgctagccgcgatgctcgggctgttgacagctagaatatcagccttggaggtc
catactcctaaagaaatctttgtggtgaatgggacacaagggaagctgacttgcacattc
gattctcctaacacaactggatggttgaccacggtctcctggagcttccagccagacggc
accgacagcgccgtgtcgtttttccactactcacaaggacaggtgtacattggggattat
ccaccatttaaagaccgagtcacctgggctggggaccttgacaagaaagatgcatcaatc
aatatagaaaatattcaggctgttcacaatggcacctatatctgcgatgtcaaaaatcct
cctgacattgttgtgcggcctggacacattaggctccacgtggtggaaatagacaacctg
ttggtgttcctggtttgggtggtggtgggcactgtcactgctgtggtccttggcctcact
ctgctcatcagcttggtcctggtcgtcctctacagaaggaaacattcgaagcgggattat
accggctgcagtacctcagagcgtttgtcaccagttaagcaggctccacggaagtgtccc
tccgacacagagggtctagtaaagagtccgccttccgccggatctcaccagggcccagtc
atttacgcacagttagaccactctggcggacaccacagcggcaagattaataagtcagag
tcggttgtgtatgcggacatccggaaagactaa

DBGET integrated database retrieval system