KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
17749 (Polr2k)
09124 Replication and repair
03420 Nucleotide excision repair
17749 (Polr2k)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
17749 (Polr2k)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
17749 (Polr2k)
03400 DNA repair and recombination proteins [BR:mmu03400]
17749 (Polr2k)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
17749 (Polr2k)
RNA polymerase III system
RNA polymerase III
17749 (Polr2k)
RNA polymerase I system
RNA polymerase I
17749 (Polr2k)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
17749 (Polr2k)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
245841 (Polr2h)
09124 Replication and repair
03420 Nucleotide excision repair
245841 (Polr2h)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
245841 (Polr2h)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
245841 (Polr2h)
03400 DNA repair and recombination proteins [BR:mmu03400]
245841 (Polr2h)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
245841 (Polr2h)
RNA polymerase III system
RNA polymerase III
245841 (Polr2h)
RNA polymerase I system
RNA polymerase I
245841 (Polr2h)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
245841 (Polr2h)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
26939 (Polr3e)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
26939 (Polr3e)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
26939 (Polr3e)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
66420 (Polr2e)
09124 Replication and repair
03420 Nucleotide excision repair
66420 (Polr2e)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
66420 (Polr2e)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
66420 (Polr2e)
03400 DNA repair and recombination proteins [BR:mmu03400]
66420 (Polr2e)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
66420 (Polr2e)
RNA polymerase III system
RNA polymerase III
66420 (Polr2e)
RNA polymerase I system
RNA polymerase I
66420 (Polr2e)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
66420 (Polr2e)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
66491 (Polr2l)
09124 Replication and repair
03420 Nucleotide excision repair
66491 (Polr2l)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
66491 (Polr2l)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
66491 (Polr2l)
03400 DNA repair and recombination proteins [BR:mmu03400]
66491 (Polr2l)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
66491 (Polr2l)
RNA polymerase III system
RNA polymerase III
66491 (Polr2l)
RNA polymerase I system
RNA polymerase I
66491 (Polr2l)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
66491 (Polr2l)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
67005 (Polr3k)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
67005 (Polr3k)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
67005 (Polr3k)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
67065 (Polr3d)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
67065 (Polr3d)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase III system
RNA polymerase III
Pol III specific subunits
67065 (Polr3d)