KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
17749 (Polr2k)
09124 Replication and repair
03420 Nucleotide excision repair
17749 (Polr2k)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
17749 (Polr2k)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
17749 (Polr2k)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
17749 (Polr2k)
03400 DNA repair and recombination proteins [BR:mmu03400]
17749 (Polr2k)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
17749 (Polr2k)
RNA polymerase III system
RNA polymerase III
17749 (Polr2k)
RNA polymerase I system
RNA polymerase I
17749 (Polr2k)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
17749 (Polr2k)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
245841 (Polr2h)
09124 Replication and repair
03420 Nucleotide excision repair
245841 (Polr2h)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
245841 (Polr2h)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
245841 (Polr2h)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
245841 (Polr2h)
03400 DNA repair and recombination proteins [BR:mmu03400]
245841 (Polr2h)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
245841 (Polr2h)
RNA polymerase III system
RNA polymerase III
245841 (Polr2h)
RNA polymerase I system
RNA polymerase I
245841 (Polr2h)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
245841 (Polr2h)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
66420 (Polr2e)
09124 Replication and repair
03420 Nucleotide excision repair
66420 (Polr2e)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
66420 (Polr2e)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
66420 (Polr2e)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
66420 (Polr2e)
03400 DNA repair and recombination proteins [BR:mmu03400]
66420 (Polr2e)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
66420 (Polr2e)
RNA polymerase III system
RNA polymerase III
66420 (Polr2e)
RNA polymerase I system
RNA polymerase I
66420 (Polr2e)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
66420 (Polr2e)
KEGG Orthology (KO) [BR:mmu00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
66491 (Polr2l)
09124 Replication and repair
03420 Nucleotide excision repair
66491 (Polr2l)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
66491 (Polr2l)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
66491 (Polr2l)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:mmu03021]
66491 (Polr2l)
03400 DNA repair and recombination proteins [BR:mmu03400]
66491 (Polr2l)
Transcription machinery [BR:mmu03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
66491 (Polr2l)
RNA polymerase III system
RNA polymerase III
66491 (Polr2l)
RNA polymerase I system
RNA polymerase I
66491 (Polr2l)
DNA repair and recombination proteins [BR:mmu03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
66491 (Polr2l)
172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS