KEGG   Mus musculus (mouse): 17777Help
Entry
17777             CDS       T01002                                 

Gene name
Mttp, 1810043K16Rik, MTP
Definition
(RefSeq) microsomal triglyceride transfer protein
  KO
K14463  microsomal triglyceride transfer protein large subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    17777 (Mttp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vitellogenin_N ArgoN
Motif
Other DBs
NCBI-GeneID: 17777
NCBI-ProteinID: NP_032668
MGI: 106926
Ensembl: ENSMUSG00000028158
Vega: OTTMUSG00000052744
UniProt: O08601
LinkDB All DBs
Position
3 G3; 3 64.06 cM
AA seq 894 aa AA seqDB search
MILLAVLFLCFFSSYSASVKGHTTGLSLNNERLYKLTYSTEVFLDGGKGKPQDSVGYKIS
SDVDVVLLWRNPDGDDDQVIQVTITAVNVENAGQQRGEKSIFQGKSTPKIIGKDNLEALQ
RPMLLHLVRGKVKEFYSYENEPVGIENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA
QQDKVVKIKALDTCKIERSGFTTANQVLGVSSKATSVTTYKIEDSFVTAVLAEETRAFAL
NFQQTIAGKIVSKQKLELKTTEAGPRMIPGKQVAGVIKAVDSKYKAIPIVGQVLERVCKG
CPSLAEHWKSIRKNLEPENLSKAEAVQSFLAFIQHLRTSRREEILQILKAEKKEVLPQLV
DAVTSAQTPDSLEAILDFLDFKSDSSIILQERFLYACGFATHPDEELLRALLSKFKGSFA
SNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKNA
LLPEGIPLLLKYAEAGEGPVSHLATTVLQRYDVSFITDEVKKTLNRIYHQNRKVHEKTVR
TTAAAVILKNPSYMDVKNILLSIGELPKEMNKYMLTVVQDILHFEMPASKMIRRVLKEMA
VHNYDRFSKSGSSSAYTGYVERSPRAASTYSLDILYSGSGILRRSNLNIFQYIGKAELHG
SQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSAS
GDPVSVVKGLILLIDHSQDIQLQSGLKANMEIQGGLAIDISGSMEFSLWYRESKTRVKNR
VAVVITSDVTVDASFVKAGVESRAETEAGLEFISTVQFSQYPFLVCMQMDKAEAPLRQFE
TKYERLSTGRGYVSRRRKESLVAGCELPLHQENSEMCNVVFPPQPESDNSGGWF
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcttggcagtgctttttctctgcttcttctcctcctactctgcttccgttaaa
ggtcacacaactggcctctcattaaataatgagcggctatacaagctcacgtactccact
gaagtgtttcttgatgggggcaaaggaaaaccgcaagacagcgtgggctacaaaatctca
tctgatgtggacgttgtgttactgtggaggaatcctgatggtgatgatgatcaagtgatc
caagtcacgataacagctgttaacgttgaaaatgcgggtcaacagagaggcgagaagagc
atcttccagggcaaaagtacacctaagatcatagggaaggacaacctggaggctctgcag
agacccatgcttcttcatctggtccgggggaaggtcaaggagttctactcctatgaaaac
gagccagtgggcatagaaaatctcaagagaggcttggctagcttattccagatgcagcta
agctctggaactaccaacgaggtagatatctctggggattgtaaagtgacctaccaggcc
cagcaagacaaagtggtcaaaattaaggctctggatacatgcaaaattgagcggtctgga
tttacaacggcaaaccaggtgctgggtgtcagttcaaaagccacatctgtcactacctac
aagatagaggacagctttgtcaccgctgtgcttgcagaagagaccagggcttttgccttg
aacttccaacaaaccatagcaggaaaaatagtgtcgaagcagaaattggagctgaagaca
actgaagccggcccaaggatgatccccgggaagcaagtggcaggtgtaattaaagcagtt
gattccaaatacaaagccattcccattgtgggacaggtcctcgagcgtgtctgcaaagga
tgcccttctctggcggagcactggaagtccatcagaaagaacctggagcctgaaaacctg
tccaaggccgaggccgtccagagcttcctggccttcattcagcacctccggacttcgagg
agagaagagatcctccagattctgaaggcagagaagaaagaagtgctccctcagctggtg
gatgccgtcacctctgctcagactccagactcgctagaagccatcctggactttttggat
ttcaaaagtgacagcagtatcatactccaggaaaggttcctctatgcctgtggctttgcc
acccaccctgatgaagaactcctacgagccctccttagtaagttcaaaggttcctttgca
agcaacgacatcagagagtcggttatgatcatcattggagccctggtcaggaagctgtgt
cagaatgaaggctgcaagctcaaggcagtggtggaagctaagaagctgatcctgggagga
cttgaaaaaccagagaagaaagaagacaccacaatgtacctgctggccctgaagaatgcc
ttgcttcccgaaggcatcccgctccttctgaagtatgctgaggctggagaagggcccgtc
agccacctggccaccactgttctccagagatacgatgtctccttcatcacagatgaggtg
aagaagaccttgaacaggatataccaccagaatcgtaaggttcatgagaagacggtgcgc
acaactgccgctgctgtcatcttaaagaacccatcctacatggatgtgaagaacatcctg
ctgtccattggggaactcccgaaagagatgaacaaatacatgctcactgttgtgcaagac
atcctgcattttgaaatgcctgcaagcaaaatgatccgtcgagttctcaaggagatggct
gttcacaattatgaccgtttctccaagagtggatcctcttctgcctatactggctacgta
gaacgtagcccccgtgcagcgtccacatacagccttgacatcctttactctggctctggc
attctgaggagaagtaacctgaacatcttccagtacatcgggaaggcagagcttcatggt
agtcaggtggtgattgaagcccaagggctggaaggcttaattgcagccactcctgatgaa
ggagaggagaaccttgactcttatgctggcatgtcagccatcctgtttgatgttcagctt
aggcctgtcacattttttaatggatacagtgatttgatgtccaaaatgctgtcggcatcc
ggcgaccctgtcagcgtggtgaaagggcttattctgttaatagaccattctcaggatatt
cagctgcaatctggactaaaggccaatatggagatccagggtggtctagctattgatatt
tctggttcaatggaattcagtctgtggtatcgagagtctaaaacccgagtgaaaaatcgg
gtggctgtggtgataaccagcgacgtcacagtggatgcctcttttgtgaaagctggtgtg
gaaagcagagcggagacagaggctgggctggagttcatctccacagtgcagttctcacag
tacccgttcttggtctgcatgcagatggacaaggctgaagccccactcaggcaattcgag
acaaagtatgaaaggctatctacaggcaggggatatgtctctcggagaagaaaagagagc
ctagtggccggatgtgaactccccctccatcaagagaactctgagatgtgcaacgtggta
ttcccacctcagccagaaagcgataactccggtggatggttttga

DBGET integrated database retrieval system