KEGG   Mus musculus (mouse): 17850Help
Entry
17850             CDS       T01002                                 

Gene name
Mut, D230010K02Rik, Mcm
Definition
(RefSeq) methylmalonyl-Coenzyme A mutase
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    17850 (Mut)
   00640 Propanoate metabolism
    17850 (Mut)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    17850 (Mut)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     17850 (Mut)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MM_CoA_mutase B12-binding
Motif
Other DBs
NCBI-GeneID: 17850
NCBI-ProteinID: NP_032676
MGI: 97239
Ensembl: ENSMUSG00000023921
UniProt: P16332 Q9CSI4
LinkDB All DBs
Position
17 B2; 17 19.55 cM
AA seq 748 aa AA seqDB search
MLRAKNQLFLLSPHYLKQLNIPSASRWKRLLHQQQPLHPEWAVLAKKQLKGKNPEDLIWH
TPEGISIKPLYSRADTLDLPEELPGVKPFTRGPYPTMYTYRPWTIRQYAGFSTVEESNKF
YKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKM
SVSMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKII
ADIFQYTAQHMPKFNSISISGYHMQEAGADAILELAYTIADGLEYCRTGLQAGLTIDEFA
PRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQD
PYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPKVA
DPWGGSYMMESLTNDVYEAALKLIYEVEEMGGMAKAVAEGIPKLRIEECAARRQARIDSG
SEVIVGVNKYQLEKEDSVEVLAIDNTSVRKKQIEKLKKIKSSRDQALAEQCLSALTQCAA
SGDGNILALAVDAARARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIK
RVNKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAV
DADVHAVGVSTLAAGHKTLVPELIKELTALGRPDILVMCGGVIPPQDYEFLYEVGVSNVF
GPGTRIPRAAVQVLDDIEKCLAEKQQSV
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagctaagaatcaactttttttgctatcgccccattacctgaagcagctaaac
attccatcagcttccagatggaaacgccttctacaccagcagcaaccccttcacccagaa
tgggctgtactggccaaaaagcagctgaaaggcaaaaacccagaggaccttatatggcac
accccagaagggatctctataaagcccttatattccagggcagatactctggacttaccc
gaagaacttccaggagtgaagccattcacacggggaccatatcctaccatgtatacctat
aggccctggaccatccgtcagtatgcaggctttagtactgtggaagaaagcaataaattc
tataaggacaatattaaggctggtcagcaggggttgtctgttgcctttgacttggcaaca
catcgtggttatgattcagacaaccccagagttcgtggagatgttggaatggctggagtt
gctattgacactgtagaagacaccaaaatcctatttgatggcattcctttagaaaaaatg
tccgtttccatgactatgaacggagctgtcatcccagtcctggcaacatttatagtaact
ggggaagagcaaggtgtgccgaaggagaagctcactggcacaattcagaatgacatccta
aaggagtttatggtcagaaatacttatatttttcccccagagccatcgatgaaaattatt
gctgacattttccaatacacagcacagcacatgccaaaatttaattccatttcgattagc
gggtaccatatgcaggaagcaggagctgatgccattttagaactggcctataccatcgca
gatgggttggagtactgcagaactggactccaggctggactcacaattgatgaatttgca
ccaaggttgtctttcttctggggaattggaatgaacttctacatggaaatagccaagatg
cgagctgggagaagactgtgggctcacttaatagaaaaaatgttccagcctaaaaactct
aaatctcttcttctaagagcacactgccagacatcggggtggtcacttactgagcaggat
ccttacaataacattgtccgcactgcaatcgaagccatggcagctgtgtttggaggaacc
cagtctttgcatacgaactcttttgatgaagcgctgggtttgcccactgtgaaaagtgcc
cggattgctcggaacacacagatcatcattcaggaagaatctgggatccccaaagtggcg
gatccttggggagggtcgtacatgatggagtcgctcacaaatgacgtttatgaggctgct
ctgaagttgatatatgaagttgaagaaatgggtggaatggccaaagctgtagctgaagga
atccctaaacttcgcattgaagaatgtgctgcccgaagacaagctagaatagattctggt
tctgaggtaattgttggagtaaataagtatcagttggaaaaagaagactctgtggaggtc
ctggccattgacaacacttcagtgcgtaagaagcagattgaaaaactcaagaagattaaa
tccagcagggatcaagctttggctgagcagtgtctcagtgcacttacccagtgtgctgcc
agtggagatggcaatattctggctctggcagtggatgcagctcgtgcaagatgtacagtt
ggagaaatcacggatgccttgaaaaaagtatttggtgagcataaagctaatgatcgtatg
gtgagtggagcatatcggcaggagtttggagaaagtaaagagatcacatctgccatcaag
agagttaataaattcatggaacgtgaaggtcgcagacctcgtcttcttgtggcaaaaatg
ggacaagatggccatgacaggggagccaaggtcattgctacaggatttgctgatcttggt
tttgatgtggacataggccctctttttcagactccccgtgaagtggcgcagcaagctgtg
gatgcagatgtccatgctgtgggtgtcagcacacttgctgctggtcataaaaccctcgtt
cctgagcttatcaaagaactcaccgccctggggcggccagatatccttgtcatgtgtggg
ggcgtgattccaccacaggattatgaatttctgtatgaagttggtgtttccaacgtcttt
ggtcctggaacccggattccaagagctgctgtccaagtgcttgatgatattgagaagtgt
ttggcagagaagcagcagtctgtgtaa

DBGET integrated database retrieval system