KEGG   Mus musculus (house mouse): 18189
Entry
18189             CDS       T01002                                 
Symbol
Nrxn1, 1700062G21Rik, 9330127H16Rik, A230068P09Rik, mKIAA0578
Name
(RefSeq) neurexin I
  KO
K07377  neurexin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18189 (Nrxn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18189 (Nrxn1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    18189 (Nrxn1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Syndecan Laminin_G_3 DUF202
Other DBs
NCBI-GeneID: 18189
NCBI-ProteinID: NP_001333888
MGI: 1096391
Ensembl: ENSMUSG00000024109
UniProt: P0DI97
LinkDB
Position
17:complement(90341072..91400587)
AA seq 468 aa
MYQRMLRCGADLGSPGGGSGGGAGGRLALIWIVPLTLSGLLGVAWGASSLGAHHIHHFHG
SSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTV
QKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTR
SGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQ
ATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTEST
ATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCE
PSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRD
EGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtaccagaggatgcttcggtgcggcgccgatctgggatcgcccgggggcggcagtggc
ggcggcgcaggggggcgcctggccctgatctggatagtcccgctcaccctcagcggcctc
ctaggagtggcctggggggcatccagtttgggagcgcaccacatccaccatttccatggc
agcagcaagcatcattcagtgcctattgcaatctacaggtcaccagcatccttgcgaggc
ggacacgctgggacaacatatatctttagcaaaggtggtggacagattacatataagtgg
cctcccaatgaccgccccagtacacgagcagacaggctggccatcggatttagcactgtc
cagaaggaagccgtgttggtgcgtgtggacagttcctcaggactgggtgactacctggag
ctgcacatacaccaaggaaaaattggagttaagtttaatgttgggacagatgacatcgcc
atcgaagagtctaatgcaatcattaatgatgggaaataccatgtagtacgtttcacaagg
agtggtggcaatgccacgttacaggtggacagctggccagttatcgaacgctaccctgca
ggaaacaatgataacgagcgcctggcgattgctagacagcgaattccatatcgacttggt
cgagtagttgatgaatggctactcgacaaagggcgtcagctcacaatcttcaatagccaa
gcaaccataataattggcgggaaagagcagggccagcccttccagggccagctctctggt
ctttactacaatggcttgaaagttctgaatatggcagcagagaacgatgccaacatcgcc
atagtggggaatgtgaggctggtcggtgaagtgccttcctctatgacaactgagtcgaca
gccactgccatgcagtctgagatgtccacctcaatcatggagaccaccacaaccctggct
accagcacagctagaagaggcaagccccccacaaaggaacccatcagccagaccacagat
gacatccttgtggcctcggcagagtgtcccagtgacgatgaggacattgacccctgtgag
ccgagctcaggtgggttagccaaccccaccagagtaggtggccgtgaaccatacccaggc
tctgcagaggtgattcgggagtccagcagtaccactggcatggtggtggggattgtcgca
gcagccgctctgtgcatcctcatcctcctctatgccatgtacaagtacaggaaccgggat
gaagggtcgtaccacgtggatgagagtcgaaactacatcagtaactcagcacagtccaat
ggggctgtggtcaaggagaagcaacccagcagtgctaaaagcgccaacaaaaacaagaaa
aacaaggataaggagtattacgtctga

KEGG   Mus musculus (house mouse): 18190
Entry
18190             CDS       T01002                                 
Symbol
Nrxn2, 6430591O13Rik, mKIAA0921
Name
(RefSeq) neurexin II
  KO
K07377  neurexin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18190 (Nrxn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18190 (Nrxn2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    18190 (Nrxn2)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan DUF202 hEGF
Other DBs
NCBI-GeneID: 18190
NCBI-ProteinID: NP_001192163
MGI: 1096362
Ensembl: ENSMUSG00000033768
UniProt: E9PUM9
LinkDB
Position
19:6468786..6583247
AA seq 1703 aa
MALGSRWQPPPQLPPLLLLLALAAGVRGLEFGGGPGQWARYARWAGAASTGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFF
YIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCE
DVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGAGVGSHSS
TQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSR
STPFLATGESEVLDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRS
RDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVCE
REATVLSYDGSMYMKIMLPTAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDG
GQMRLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQ
MAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELN
ARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIV
IELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHS
NGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIG
QVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGAL
ITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVG
TDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRI
PYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAES
DPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTMRD
STTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPPP
TFYPFLTGVGATQDTLPPPAARRPSSGGPCQAERDDSDCEEPVEASGFASGEVFDSSLPP
TDDEDFYTTFPLVTDRTTLLSPRKPRPNLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRD
PLQPLLENPPLGPGVPTAFEPRRPPPLRPGVTSAPGFPRLPTANPTGPGERGPPGAVEVI
RESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVK
EKAPAAPKTPSKAKKNKDKEYYV
NT seq 5112 nt   +upstreamnt  +downstreamnt
atggcgctcgggagtcggtggcaaccgccaccccagctgccgccgctgctgttgctgctg
gcgctggcggcaggcgtccgtggcttggagttcggcggcggccccgggcagtgggctcgc
tacgcgcgttgggcgggagcggcgagcaccggcgagctcagcttcagcctgcgcaccaac
gccacgcgcgcgctgctgctctacctggacgacggcggcgactgcgacttcttggagctg
ctgctggtggacgggcgcctgcggctgcgcttcacgctgtcttgcgcggagcccgccacg
ctgcagctggacacgccggtggccgacgaccgctggcacatggtgttgctgacccgcgac
gcgcggcgcacggcgctggcggtggacggcgaagcccgcgccgccgaggtccgctcaaag
cggcgcgagatgcaggtggccagcgacctgttcgtgggcggcatccctcccgacgtgcgc
ctatctgcactcacgctcagcaccgtcaagtacgagccgcctttccgcggccttctggcc
aacctgaagctgggcgagcggccgccggcgctgctgggtagccagggtctgcgcggtgcg
gccgccgaccctctgtgtgcgcctgcgcgcaatccctgcgccaacggcggtctctgcacc
gtgctagcccccggcgaggtgggctgcgactgcagccacactggatttggcggcaagttc
tgcagtgaagaggaacaccccatggaaggtccggctcacctgacgttaaacagcgaagta
gggtccttactgttctccgaggggggggccgggagaggaggagccggcgatgtgcaccag
ccgacaaaaggcaaggaggaatttgtggcaaccttcaagggcaatgagttcttctgctac
gacctgtcccacaacccgatccagagcagcactgacgagatcacactggccttccgcacc
ctgcagcgcaacgggctgatgctgcacacggggaagtcggctgactacgtcaacctgtcc
ctcaagtctggggctgtctggctggtcatcaacctaggctcaggtgccttcgaggccctc
gtggaacccgtcaatggcaagttcaacgacaacgcctggcacgacgtccgggttacccga
aacctgcgccagcacgcagggattggacacgctatggtgaccatctcggtggacgggatc
ctgaccaccacaggctacacgcaggaggattacaccatgctgggctctgatgacttcttc
tacattgggggcagccccaacacagccgacctgcctggctcacctgtcagcaacaacttc
atgggctgcctcaaggacgtggtctacaagaataatgacttcaagctggagctgtcccga
ctggctaaggaaggggacccgaagatgaagctgcagggggatttgtctttccgttgtgag
gatgtggctgccttggaccctgtgacctttgagagtcctgaggcctttgtcgcactgccc
cgctggagcgccaagcgcactggttccatctccctggacttcagaaccactgagcccaat
gggttgttgctcttcagccagggccggcgggctggggccggggtaggcagtcacagttct
acccagagggccgactactttgccatggagctgttggatggctacctctaccttctgctg
gacatgggctccgggggcatcaagctgcgggcgtctagccgcaaggtcaatgatggtgaa
tggtgccacgtggacttccagagggacgggcgcaaaggctccatctctgtgaacagccgc
agcacgccattcttggccacaggagagagcgaggtcctggacctggagagtgagctgtac
ctgggcggtctccccgaggggggacgagtggacctgccactgccccctgaggtgtggaca
gctgctctccgggctggctacgtgggctgtgtgagagacctcttcatcgatggacggagt
cgagatctccggggcctggctgaggcccagggggctgtgggcgttgctcctttctgctcc
cgggagaccctgaagcagtgtgcgtcggccccttgtcgaaacgggggcatctgtcgagag
ggctggaaccggttcgtctgtgactgcatcgggaccggctttctgggtcgggtctgcgag
agagaggccacggtcttaagctatgacggctccatgtacatgaagatcatgctgcccact
gcgatgcacacggaagcagaggatgtgtccttacgcttcatgtctcagagggcatatgga
ctcatgatggccaccacctccagggagtcggctgacactctgcgtctcgagctggacggg
gggcagatgaggctcaccgtcaacctcgactgcctgcgcgtcggctgcgcacccagtaaa
ggccccgagacactgtttgcggggcacaagctgaatgacaatgaatggcacacggtgagg
gtggtccggcgtggcaagagcctgcagctgtccgtggacaacgtgactgtggagggacag
atggcaggagcccacactcggctggagttccacaacattgagacgggcattatgacagag
cggcggtttatctctgtggtgccctccaacttcatcgggcacctgagtgggctggtgttc
aatggtcaaccctacatggaccaatgcaaagatggagacatcacctattgtgagcttaat
gcccgctttggcctgcgtgccatcgtggctgatcctgtcacgttcaagagtcgcagcagc
tacctggcgttagccacgctgcaagcctatgcttccatgcatctcttcttccagttcaag
accacggccccagatggacttctgctgttcaactcaggcaacggcaacgacttcatcgtc
atcgagttggtcaaggggtacatccactacgtgtttgacctgggaaatggcccgtccttg
atgaagggaaactcagacaaaccagtcaatgacaaccaatggcacaatgtggtggtgtcc
agggacccaggcaacgtgcacacactgaagatcgactcccgcacagtcacgcagcattcc
aacggtgcccgaaatctggatctcaaaggggagttgtatatcggtggcctgagcaagaat
atgttcagcaacctgcccaagctggtggcctctcgggatggctttcaaggctgcttggct
tctgtggacctcaacggacgcctcccagacctcatcgctgacgccctgcaccgcatcggg
caggtggagaggggctgtgatggccctagcaccacctgcaccgaagagtcttgtgccaac
cagggcgtctgtctgcagcagtgggatggttttacctgtgactgtactatgacttcctat
ggaggccctgtctgcaatgaccctgggaccacatacatcttcgggaaggggggagcgctc
atcacctatacatggcctcccaatgaccggcccagtacacggatggaccgcctggccgta
ggcttcagcacacaccagcggagcgctgtgctggtgcgagtggacagtgcctccggcctc
ggggactacttgcagctgcacattgaccagggcactgttggggtgatttttaatgtgggc
acggacgacattacaattgatgagcccaacgccatcgtgagcgacggcaaatatcacgtg
gtgcgctttactcgaagtggtggcaatgccaccttgcaagtggacagctggccagtcaac
gagaggtacccggcaggaaactttgataacgagcgcctggcgattgctagacagagaatc
ccctaccggcttggtcgagtagtagatgagtggctgctcgacaaaggacgccagctgacc
atcttcaacagccaggctgccatcaagatagggggccgggatcagggccgccccttccag
ggccaggtgtccggcctctactacaatgggctcaaggtactggcgctggccgccgagagc
gaccccaatgtgcggaccgaaggccacctacggctagtaggggaggggccgtccgtgctg
ctcagtgctgagaccactgccaccactctgctggccgacatggccaccaccatcatggag
accaccaccaccatggccaccaccactactcgccggggccgttcccccacaatgagggac
agcaccacccagaacacagatgacctcctggtggcctcggctgagtgtccaagtgatgat
gaggacctagaggagtgtgagcctagtactggaggagagttaatattgcccattatcacg
gaggactccttagaccctcctcccgtggccacccgatcccccttcgtgcccccacccccc
accttctacccctttctcacgggcgtgggtgccacccaagacaccctgcctccgcccgcc
gcgcgccgcccgtcctcggggggcccgtgtcaggccgagcgcgacgacagcgactgcgag
gagcccgtggaagcctcgggcttcgcctccggggaggtctttgactccagcctccccccc
acggacgacgaggacttttacactactttccccttggtcacggaccgcaccaccctcctg
tcgccccgcaagccccgacccaacctcaggacagatggggccacgggcgcccccggggtg
ctatttgcgccctccgccccagcccccaacctgcccgcgggcaaaatgaaccaccgagac
ccactgcagccgctgctggagaacccacccctggggcctggggtccccacggccttcgag
ccgcggcggccgcctcccctgcgccccggcgtgacctcagcccccggtttcccccgtctg
cccacagccaaccccacgggtccgggggagcgcggcccgccaggtgcagtggaggtgatc
cgcgaatccagcagcaccacgggcatggtggtgggcatcgtggcggcggcggcgctctgc
atcctcattctcctctacgccatgtacaagtaccgcaaccgcgacgagggctcctaccag
gtggaccagagccggaattacatcagtaactcggcccagagcaatggggcggtggtgaag
gagaaggcccctgctgcccccaagacgccaagcaaggccaagaagaacaaagacaaagag
tattacgtctga

KEGG   Mus musculus (house mouse): 18191
Entry
18191             CDS       T01002                                 
Symbol
Nrxn3
Name
(RefSeq) neurexin III
  KO
K07377  neurexin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18191 (Nrxn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18191 (Nrxn3)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    18191 (Nrxn3)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan hEGF DUF202
Other DBs
NCBI-GeneID: 18191
NCBI-ProteinID: NP_001185516
MGI: 1096389
Ensembl: ENSMUSG00000066392
UniProt: Q6P9K9
Structure
LinkDB
Position
12:88689454..90301709
AA seq 1571 aa
MSFTLHSVFFTLKVSIFLGSLVGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETTVLSNKQVNDSSWHFLMVSRDRVR
TGLVIDGEGQSGELRPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQSMPGFKGLMLDLK
YGNSEPRLLGSQSVQLEAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGTLCSEDVSQ
GPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDVRSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKVIMPMVMHTEAEDVSFRFMSQRAYG
LLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVR
VVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMF
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLTLATLQAYTSMHLFFQFK
TTSADGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVIT
RDSSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLA
SVDLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSY
SGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGL
GDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVN
EHYPTGNTDNERLQMVKQKIPFKYNRPVEEWLQEKGRQLTIFNTQAQIAIGGKDKGRLFQ
GQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSVSGTTQTTSMPPEMSTTVMETT
TTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTDKSLSTSIFEGGYKAH
APKWESKDFRPNKVSETSRTTTTSLSPELIRFTASSSSGMVPKLPAGKMNNRDLKPQPDI
VLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGASEVIRESSSTTGMVV
GIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQASSKSGHK
KQKNKDKEYYV
NT seq 4716 nt   +upstreamnt  +downstreamnt
atgagctttaccctccactcagttttcttcaccttgaaggtgagcatctttctgggctcc
ctggtggggctttgcctgggtctggagttcatgggccttcctaaccagtgggcccgctac
ctgcgttgggatgcaagcacgcgcagtgacctgagcttccagttcaagaccaatgtttcc
actgggctgctcctgtatttggatgatggtggtgtctgtgacttcctctgtctctccctg
gtggatggccgcgttcagctccgctttagcatggactgtgccgagaccactgtgctatcc
aacaagcaggtgaacgacagcagttggcacttcctcatggtgagccgtgatcgtgtgcgc
actgggctggtgattgatggtgagggccagtctggagagctacggccccagcggccttat
atggatgtggtcagtgatttgttcctcggtggcgtccccgctgacattcgaccttctgcc
ctgaccctcgatggagtacagagcatgcctggctttaagggattaatgctggatctcaag
tatggcaactcggaacctcggcttctggggagccagagcgtccagttagaagcagaggga
ccctgtggcgagcgtccctgtgaaaatggtgggatctgcttcctcttggatggtcatccc
acctgtgactgttctaccactggctatggtggcacactctgctcagaagatgtcagtcaa
ggtccaggcctctcccatcttatgatgagtgaacaagcacgagaggagaacgtggccacc
ttccgaggctcagagtatctgtgctatgacctgtcccagaaccccatccagagcagcagc
gacgaaatcaccctttcctttaagacctggcaacgcaatgggctcatcctccacactggc
aagtcggccgactatgttaacctggctctgaaggatggtgcggtctccttggtcattaac
ctggggtccggggcctttgaggccattgtggagccagtgaatgggaaattcaacgacaac
gcctggcatgatgtcaaagtgacacgcaatcttcggcaggtgacaatctctgtggatggc
atcctaaccacaacgggctacactcaagaggactacaccatgctgggctcagatgacttc
ttctatgttggtggaagcccaagtaccgcagacttgccaggttcacctgtgagcaacaac
ttcatgggctgccttaaagaggttgtttataagaataatgacatccgtctagagctgtct
cgcttggcccggattggagacaccaagatgaaaatctatggtgaagttgtgttcaagtgt
gagaacgtggccacactggatcccatcaactttgagaccccagaggcttacatcagcttg
cccaagtggaacaccaaacgtatgggctccatttcctttgactttcgcaccactgagccc
aacggcctgattctcttcactcacgggaagcctcaagaaaggaaagatgtccggagccaa
aagaacacaaaagttgacttctttgctgtggaacttcttgatggcaacctgtatttgctg
cttgacatgggctctggcaccatcaaagtgaaggccactcagaagaaggccaatgatggg
gaatggtaccacgtggatattcagcgtgatggcagatcaggtaccatatctgtgaacagc
aggcgcacgccattcaccgccagtggggagagtgaaattctcgacctggagggggacatg
tatctgggcgggctgccagagaaccgagctggcctcatcctccccacggagctctggacc
gccatgctcaactacggttacgtgggctgcatccgcgacctgttcatcgatgggcgcagc
aagaacatccggcagctggcggagatgcagaacgcagcaggcgtcaagtcctcctgttca
cgcatgagcgccaagcagtgtgacagctacccctgcaagaacaacgcggtgtgcaaggac
ggctggaaccgcttcatctgcgactgcactggcaccggctactgggggagaacctgcgaa
agagaggcatctatcctgagctatgacggcagcatgtacatgaaggtcatcatgcccatg
gtgatgcacacggaggcagaggatgtgtccttccgcttcatgtcacagcgagcctatggg
ctactggtagccacaacctccagggattctgcagatacactgcgtctagagttggatggt
gggcgtgtcaagctcatggttaacttagactgtatcaggataaactgtaactccagcaaa
ggacctgagaccctgtatgcagggcagaagctcaatgacaatgagtggcacaccgtccgg
gtagtgcggagaggaaaaagccttaagctaacagtggatgatgatgtggctgaggggaca
atggtgggcgaccacacccgcctggaattccacaatattgaaactggtatcatgactgag
aagcgttacatctctgtggtcccctccagtttcattggccatctacagagcctcatgttc
aatggcttactgtacattgatttgtgcaaaaatggcgacatcgactactgtgaactgaag
gctcgctttggactgagaaacatcatcgccgaccctgtcacttttaagaccaagagcagc
tacctgaccctcgccaccctacaggcttacacctccatgcacctcttcttccagttcaag
accacttcagctgatggcttcattctcttcaatagcggagatggcaatgattttattgca
gttgagctggtcaaggggtacatacactatgtgtttgatctcggcaatggtcccaatgtg
atcaaaggcaacagtgaccgccccctgaatgacaaccagtggcacaacgtggtcatcacc
agggacagcagtaacacccacagtctgaaggtggacaccaaggtagtcactcaggtcatc
aatggtgccaaaaatctggatttgaaaggtgacctctatatggctggcttagcccagggc
atgtacagcaaccttcccaagcttgtggcctccagggatggatttcagggctgcctggcc
tctgtggacttgaatggacgcctgcctgatctcatcaacgatgctctccacaggagtgga
cagatcgagcgaggctgtgaaggacccagtacaacctgtcaggaggattcatgcgccaac
cagggagtttgcatgcagcagtgggaaggtttcacctgtgactgctccatgacatcatat
tctggaaaccagtgcaatgaccctggtgcaacatacatctttgggaaaagcggtggcctc
atcctctatacctggccagcaaatgacagacccagcacacgctctgaccgtctcgccgtg
ggcttcagcactactgtgaaggatggtatcttagtacgcattgacagcgcccctggactt
ggcgacttcctccagcttcacatagaacaagggaaaattggagttgtcttcaatattggc
acagttgacatctccatcaaagaagagagaactcctgtcaatgatggcaaataccacgtt
gtgcgcttcaccaggaatgggggaaatgctacacttcaggtggacaactggccagtgaat
gagcactatcctacaggcaacactgataatgaacgcctccaaatggtaaaacagaaaatc
cccttcaaatataaccggcccgtagaggagtggctgcaggaaaaaggccggcagctaacc
atcttcaacacccaggcgcaaatagccatcggaggaaaggacaaaggacgtctcttccaa
ggtcaactctctgggctctattatgatggtttgaaagtactgaacatggcagctgagaac
aaccctaatattaaaatcaatggaagtgtccggctagtgggagaagtcccatcagtctca
ggaacaacacagacaacgtccatgccacctgaaatgtctaccaccgtcatggaaaccacc
accaccatggctacgaccaccacccgaaagaaccgctctacagccagcattcagcccacg
tcagatgatcttgtttcatctgctgaatgttcaagtgatgatgaagactttgtcgaatgt
gaaccaagtacagataagagtctttccacttcaatcttcgaaggtggctacaaagcacat
gcgcccaagtgggaatccaaggactttagacctaacaaagtctcggaaactagtagaact
acaaccacctctttgtcccctgagctgatccgcttcacagcgtcctcctcgtctgggatg
gtgcccaaattgccagctggcaaaatgaataaccgtgatctcaaaccccagcctgatata
gtcttgcttccgttgcccactgcctatgagctagacagcaccaaactgaagagcccacta
attacttcccccatgttccgtaatgtgcccacagcaaaccccacggagccaggaatcaga
cgggttccgggggcctcagaggtgatccgggagtccagcagtacaacagggatggtcgtc
ggcattgtggctgctgccgccctctgcatcttgatcctcctgtacgccatgtacaagtac
aggaacagggacgaggggtcctatcaagtggacgagacgaggaactacatcagcaactcg
gcccagagcaacggcacgctcatgaaggagaagcaagccagctccaagagcggccataag
aaacagaaaaacaaggacaaggagtattatgtgtaa

DBGET integrated database retrieval system