KEGG   Mus musculus (mouse): 18383Help
Entry
18383             CDS       T01002                                 

Gene name
Tnfrsf11b, OCIF, Opg, TR1
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin)
  KO
K05148  tumor necrosis factor receptor superfamily member 11B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18383 (Tnfrsf11b)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    18383 (Tnfrsf11b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    18383 (Tnfrsf11b)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   18383 (Tnfrsf11b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 18383
NCBI-ProteinID: NP_032790
MGI: 109587
Ensembl: ENSMUSG00000063727
UniProt: O08712 Q3UK97
LinkDB All DBs
Structure
PDB: 

Position
15; 15 D1
AA seq 401 aa AA seqDB search
MNKWLCCALLVLLDIIEWTTQETLPPKYLHYDPETGHQLLCDKCAPGTYLKQHCTVRRKT
LCVPCPDHSYTDSWHTSDECVYCSPVCKELQSVKQECNRTHNRVCECEEGRYLEIEFCLK
HRSCPPGSGVVQAGTPERNTVCKKCPDGFFSGETSSKAPCIKHTNCSTFGLLLIQKGNAT
HDNVCSGNREATQKCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHLGHSNLTTEQLLALME
SLPGKKISPEEIERTRKTCKSSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKTSHFPKT
VTHSLRKTMRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtggctgtgctgcgcactcctggtgctcctggacatcattgaatggacaacc
caggaaacccttcctccaaagtacttgcattatgacccagaaactggtcatcagctcctg
tgtgacaaatgtgctcctggcacctacctaaaacagcactgcacagtgaggaggaagaca
ttgtgtgtcccttgccctgaccactcttatacggacagctggcacaccagtgatgagtgt
gtgtattgcagcccagtgtgcaaggaactgcagtccgtgaagcaggagtgcaaccgcacc
cacaaccgagtgtgtgagtgtgaggaagggcgttacctggagatcgaattctgcttgaag
caccggagctgtcccccgggctccggcgtggtgcaagctggaaccccagagcgaaacaca
gtttgcaaaaaatgtccagatgggttcttctcaggtgagacttcatcgaaagcaccctgt
ataaaacacacgaactgcagcacatttggcctcctgctaattcagaaaggaaatgcaaca
catgacaacgtgtgttccggaaacagagaagccacgcaaaagtgtggaatagatgtcacc
ctgtgtgaagaggccttcttcaggtttgctgttcctaccaagattataccaaattggctg
agtgttttggtggacagtttgcctgggaccaaagtgaatgccgagagtgtagagaggata
aaacggagacacagctcacaagagcaaaccttccagctgctgaagctgtggaaacatcaa
aacagagaccaggaaatggtgaagaagatcatccaagacattgacctctgtgaaagcagc
gtgcagcggcatctcggccactcgaacctcaccacagagcagcttcttgccttgatggag
agcctgcctgggaagaagatcagcccagaagagattgagagaacgagaaagacctgcaaa
tcgagcgagcagctcctgaagctactcagtttatggaggatcaaaaatggtgaccaagac
accttgaagggcctgatgtatgccctcaagcacttgaaaacatcccactttcccaaaact
gtcacccacagtctgaggaagaccatgaggttcctgcacagcttcacaatgtacagactg
tatcagaagctctttttagaaatgatagggaatcaggttcaatccgtgaaaataagctgc
ttataa

DBGET integrated database retrieval system