KEGG   Mus musculus (house mouse): 18569
Entry
18569             CDS       T01002                                 
Symbol
Pdcd4, D19Ucla1, Ma3, Tis
Name
(RefSeq) programmed cell death 4
  KO
K16865  programmed cell death protein 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    18569 (Pdcd4)
   05205 Proteoglycans in cancer
    18569 (Pdcd4)
SSDB
Motif
Pfam: MA3 HABP4_PAI-RBP1 PCI Adhes-Ig_like
Other DBs
NCBI-GeneID: 18569
NCBI-ProteinID: NP_001161963
MGI: 107490
Ensembl: ENSMUSG00000024975
UniProt: Q61823
Structure
LinkDB
Position
19:53880662..53926024
AA seq 469 aa
MDIENEQTLNVNPTDPDNLSDSLFSGDEENAGTEEIKNEINGNWISASTINEARINAKAK
RRLRKNSSRDSGRGDSVSDNGSEAVRSGVAVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDETAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggatatagaaaatgagcagacactgaatgtgaaccccactgaccctgacaatttaagc
gactctctcttttctggagatgaagaaaatgctggcactgaagaaataaagaatgaaata
aatggaaattggatttccgcatctactattaatgaagctagaatcaatgcaaaagccaaa
agacgactgcggaaaaattcatcccgggactctggccgaggagactcagtcagtgacaat
ggaagtgaagcggttagaagtggagttgctgtgcccaccagtccaaaaggaaggttgcta
gataggcggtccagatctgggaaaggaagggggctgccaaagaaaggtggtgcaggcggc
aagggtgtctggggcacacctggacaggtgtatgatgtggaagaggtggatgtgaaagat
ccaaactatgatgacgaccaggagaactgtgtttatgaaactgtagttttgcccctggat
gagaccgcatttgagaagactctaacaccaattatacaggaatactttgagcatggagat
acaaatgaagttgcggagatgttaagagacttaaaccttggggagatgaagagtggcgtg
ccggtgttggcagtgtccttagccttggaggggaaggccagccaccgggagatgacatcc
aagctgctttctgacctttgcgggacggtgatgagcacaaatgacgtggaaaagtcattt
gacaagttgctgaaggatctccctgagctagccttggacactcctagggcaccgcagttg
gtgggccagtttattgctagagctgttggagatggaatcttatgtaatacctatatcgat
agttacaaaggaactgtagattgtgtacaggctcgagctgctctggataaggctactgtg
ctcctgagtatgtccaaaggcgggaagcggaaagacagtgtgtggggatctggaggcggg
caacagcctgtcaatcaccttgttaaagagattgatatgctgcttaaagagtatttactc
tctggagatatatctgaagctgaacactgccttaaggaactggaagtacctcattttcac
cacgagcttgtatatgaagccattgtaatggttttagagtcaactggagaaagtgcattc
aagatgatcttagatttattaaaatccttgtggaagtcttctactattaccatagaccaa
atgaaaagaggctatgagagaatttacaatgaaatcccagacattaatctggatgtccca
cactcatactctgttcttgagagatttgtggaggaatgttttcaggctggaataatttcc
aaacaactccgtgatctttgtccatcaaggggaagaaagcgttttgtaagtgaaggagat
ggaggccgtcttaaacctgagagctactga

DBGET integrated database retrieval system