Entry |
|
Symbol |
Prkacb, CbPKA, PKA_C-beta, Pkacb
|
Name |
(RefSeq) protein kinase, cAMP dependent, catalytic, beta
|
KO |
|
Organism |
mmu Mus musculus (house mouse)
|
Pathway |
mmu04213 | Longevity regulating pathway - multiple species |
mmu04261 | Adrenergic signaling in cardiomyocytes |
mmu04270 | Vascular smooth muscle contraction |
mmu04723 | Retrograde endocannabinoid signaling |
mmu04750 | Inflammatory mediator regulation of TRP channels |
mmu04914 | Progesterone-mediated oocyte maturation |
mmu04919 | Thyroid hormone signaling pathway |
mmu04923 | Regulation of lipolysis in adipocytes |
mmu04925 | Aldosterone synthesis and secretion |
mmu04927 | Cortisol synthesis and secretion |
mmu04928 | Parathyroid hormone synthesis, secretion and action |
mmu04935 | Growth hormone synthesis, secretion and action |
mmu04961 | Endocrine and other factor-regulated calcium reabsorption |
mmu04962 | Vasopressin-regulated water reabsorption |
mmu05163 | Human cytomegalovirus infection |
mmu05166 | Human T-cell leukemia virus 1 infection |
mmu05207 | Chemical carcinogenesis - receptor activation |
|
Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
18749 (Prkacb)
04014 Ras signaling pathway
18749 (Prkacb)
04310 Wnt signaling pathway
18749 (Prkacb)
04340 Hedgehog signaling pathway
18749 (Prkacb)
04371 Apelin signaling pathway
18749 (Prkacb)
04020 Calcium signaling pathway
18749 (Prkacb)
04024 cAMP signaling pathway
18749 (Prkacb)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
18749 (Prkacb)
09143 Cell growth and death
04114 Oocyte meiosis
18749 (Prkacb)
09144 Cellular community - eukaryotes
04530 Tight junction
18749 (Prkacb)
04540 Gap junction
18749 (Prkacb)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
18749 (Prkacb)
04062 Chemokine signaling pathway
18749 (Prkacb)
09152 Endocrine system
04911 Insulin secretion
18749 (Prkacb)
04910 Insulin signaling pathway
18749 (Prkacb)
04922 Glucagon signaling pathway
18749 (Prkacb)
04923 Regulation of lipolysis in adipocytes
18749 (Prkacb)
04912 GnRH signaling pathway
18749 (Prkacb)
04913 Ovarian steroidogenesis
18749 (Prkacb)
04915 Estrogen signaling pathway
18749 (Prkacb)
04914 Progesterone-mediated oocyte maturation
18749 (Prkacb)
04921 Oxytocin signaling pathway
18749 (Prkacb)
04926 Relaxin signaling pathway
18749 (Prkacb)
04935 Growth hormone synthesis, secretion and action
18749 (Prkacb)
04918 Thyroid hormone synthesis
18749 (Prkacb)
04919 Thyroid hormone signaling pathway
18749 (Prkacb)
04928 Parathyroid hormone synthesis, secretion and action
18749 (Prkacb)
04916 Melanogenesis
18749 (Prkacb)
04924 Renin secretion
18749 (Prkacb)
04925 Aldosterone synthesis and secretion
18749 (Prkacb)
04927 Cortisol synthesis and secretion
18749 (Prkacb)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
18749 (Prkacb)
04270 Vascular smooth muscle contraction
18749 (Prkacb)
09154 Digestive system
04970 Salivary secretion
18749 (Prkacb)
04971 Gastric acid secretion
18749 (Prkacb)
04976 Bile secretion
18749 (Prkacb)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
18749 (Prkacb)
04961 Endocrine and other factor-regulated calcium reabsorption
18749 (Prkacb)
09156 Nervous system
04724 Glutamatergic synapse
18749 (Prkacb)
04727 GABAergic synapse
18749 (Prkacb)
04725 Cholinergic synapse
18749 (Prkacb)
04728 Dopaminergic synapse
18749 (Prkacb)
04726 Serotonergic synapse
18749 (Prkacb)
04720 Long-term potentiation
18749 (Prkacb)
04723 Retrograde endocannabinoid signaling
18749 (Prkacb)
09157 Sensory system
04740 Olfactory transduction
18749 (Prkacb)
04742 Taste transduction
18749 (Prkacb)
04750 Inflammatory mediator regulation of TRP channels
18749 (Prkacb)
09149 Aging
04211 Longevity regulating pathway
18749 (Prkacb)
04213 Longevity regulating pathway - multiple species
18749 (Prkacb)
09159 Environmental adaptation
04713 Circadian entrainment
18749 (Prkacb)
04714 Thermogenesis
18749 (Prkacb)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
18749 (Prkacb)
05205 Proteoglycans in cancer
18749 (Prkacb)
05207 Chemical carcinogenesis - receptor activation
18749 (Prkacb)
05203 Viral carcinogenesis
18749 (Prkacb)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
18749 (Prkacb)
05163 Human cytomegalovirus infection
18749 (Prkacb)
05165 Human papillomavirus infection
18749 (Prkacb)
09174 Infectious disease: parasitic
05146 Amoebiasis
18749 (Prkacb)
09164 Neurodegenerative disease
05012 Parkinson disease
18749 (Prkacb)
05020 Prion disease
18749 (Prkacb)
09165 Substance dependence
05030 Cocaine addiction
18749 (Prkacb)
05031 Amphetamine addiction
18749 (Prkacb)
05032 Morphine addiction
18749 (Prkacb)
05034 Alcoholism
18749 (Prkacb)
09166 Cardiovascular disease
05414 Dilated cardiomyopathy
18749 (Prkacb)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
18749 (Prkacb)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
18749 (Prkacb)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:mmu01001]
18749 (Prkacb)
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:mmu03019]
18749 (Prkacb)
03036 Chromosome and associated proteins [BR:mmu03036]
18749 (Prkacb)
Enzymes [BR:mmu01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.11 cAMP-dependent protein kinase
18749 (Prkacb)
Protein kinases [BR:mmu01001]
Serine/threonine kinases: AGC group
PKA family
18749 (Prkacb)
Messenger RNA biogenesis [BR:mmu03019]
Eukaryotic type
mRNA surveillance and transport factors
mRNA cycle factors
Common to processing body (P body) and stress granule
18749 (Prkacb)
Chromosome and associated proteins [BR:mmu03036]
Eukaryotic type
Centrosome formation proteins
Kinases and associated factors
18749 (Prkacb)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
3:complement(146435334..146518691)
|
AA seq |
351 aa
MGNTAIAKKGSEVESVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKEFCEF |
NT seq |
1056 nt +upstreamnt +downstreamnt
atggggaacactgcgatcgccaagaaaggcagcgaagtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttctgaggaaatgggagaaccctcccccgagtaatgctggg
cttgaggattttgagaggaagaaaaccctcgggacgggttcctttggaagagtcatgttg
gtgaagcataaagccactgagcagtactacgccatgaagatcttagacaagcagaaggtt
gttaagctgaagcaaatagagcacactctgaatgagaagagaatcctgcaggccgtggag
ttcccgttccttgtgcggctggagtactcttttaaggataattctaatttatacatggtt
atggaatacgtccctgggggagagatgttctcacatctgagaagaattggaaggttcagt
gagccccacgcccgtttctatgcagcccagattgtgctaacatttgagtaccttcattcc
ctcgacctcatctacagagatctcaagccggaaaacctcttaattgaccaccagggttac
atccaggtcacagatttcgggttcgccaaaagagtcaagggcaggacatggacattgtgt
ggcaccccagagtacctggccccggagatcatcctcagcaagggttacaataaggcggtg
gactggtgggcactgggcgtgctgatctatgagatggctgctggctaccctccattcttt
gctgaccagccaattcagatctatgagaagattgtctctggaaaggtccggttcccatca
cacttcagctccgatctcaaggaccttctgcggaacctgctgcaggtggatctgacaaag
cgattcgggaacctgaagaacggcgtgagtgacataaagacccacaagtggtttgccaca
actgactggattgctatttatcagagaaaggttgaggctccattcataccaaagttcaga
ggctctggcgataccagcaacttcgatgactatgaagaagaagaaatccgtgtgtctata
acagaaaaatgtggaaaggaattttgtgaattttag |