KEGG   Mus musculus (mouse): 18999Help
Entry
18999             CDS       T01002                                 

Gene name
Pou5f1, NF-A3, Oct-3, Oct-3/4, Oct-4, Oct3, Oct3/4, Oct4, Otf-3, Otf-4, Otf3, Otf3-rs7, Otf3g, Otf4
Definition
(RefSeq) POU domain, class 5, transcription factor 1
  KO
K09367  POU domain transcription factor, class 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    18999 (Pou5f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18999 (Pou5f1)
   03021 Transcription machinery [BR:mmu03021]
    18999 (Pou5f1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   POU domain factors
    18999 (Pou5f1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     18999 (Pou5f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain DUF521 Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 18999
NCBI-ProteinID: NP_038661
MGI: 101893
Ensembl: ENSMUSG00000024406
Vega: OTTMUSG00000037235
UniProt: P20263
LinkDB All DBs
Structure
PDB: 

Position
17 B1; 17 18.69 cM
AA seq 352 aa AA seqDB search
MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPP
AYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLE
KVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRF
EALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLET
MFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPG
GAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctggacacctggcttcagacttcgccttctcacccccaccaggtgggggtgatggg
tcagcagggctggagccgggctgggtggatcctcgaacctggctaagcttccaagggcct
ccaggtgggcctggaatcggaccaggctcagaggtattggggatctccccatgtccgccc
gcatacgagttctgcggagggatggcatactgtggacctcaggttggactgggcctagtc
ccccaagttggcgtggagactttgcagcctgagggccaggcaggagcacgagtggaaagc
aactcagagggaacctcctctgagccctgtgccgaccgccccaatgccgtgaagttggag
aaggtggaaccaactcccgaggagtcccaggacatgaaagccctgcagaaggagctagaa
cagtttgccaagctgctgaagcagaagaggatcaccttggggtacacccaggccgacgtg
gggctcaccctgggcgttctctttggaaaggtgttcagccagaccaccatctgtcgcttc
gaggccttgcagctcagccttaagaacatgtgtaagctgcggcccctgctggagaagtgg
gtggaggaagccgacaacaatgagaaccttcaggagatatgcaaatcggagaccctggtg
caggcccggaagagaaagcgaactagcattgagaaccgtgtgaggtggagtctggagacc
atgtttctgaagtgcccgaagccctccctacagcagatcactcacatcgccaatcagctt
gggctagagaaggatgtggttcgagtatggttctgtaaccggcgccagaagggcaaaaga
tcaagtattgagtattcccaacgagaagagtatgaggctacagggacacctttcccaggg
ggggctgtatcctttcctctgcccccaggtccccactttggcaccccaggctatggaagc
ccccacttcaccacactctactcagtcccttttcctgagggcgaggcctttccctctgtt
cccgtcactgctctgggctctcccatgcattcaaactga

DBGET integrated database retrieval system