KEGG   Mus musculus (house mouse): 192167
Entry
192167            CDS       T01002                                 
Symbol
Nlgn1, 6330415N05Rik, BB179718, NL1, Nlg1, mKIAA1070
Name
(RefSeq) neuroligin 1
  KO
K07378  neuroligin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    192167 (Nlgn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    192167 (Nlgn1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    192167 (Nlgn1)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE
Other DBs
NCBI-GeneID: 192167
NCBI-ProteinID: NP_619607
MGI: 2179435
Ensembl: ENSMUSG00000063887
UniProt: Q99K10
Structure
LinkDB
Position
3:complement(25475972..26387504)
AA seq 843 aa
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDDVDPLVTTNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDGPLTKKHTDDLGDNDG
AEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLST
GDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNR
WSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYK
ELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIV
DSDDGVSASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALF
TDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGP
TELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQ
KDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITLRPTR
KNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPP
DYTLAMRRSPDDIPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHST
TRV
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcacttcccagatgcatgtggccaaattatgtttggagagctatgatggcatgtgtg
gtccacaggggatccggtgccccattgactctctgcttgttgggatgtttgctacagact
tttcacgtactctctcaaaagttggatgatgtagacccattggttactactaactttggc
aagattaggggaattaagaaagaactcaataatgaaattttgggtcctgtcattcagttt
cttggggttccatatgccgctccaccaacaggagaacatcgtttccagcctccagaacca
ccatctccctggtctgacatccggaacgccactcagtttgctcctgtatgtccccagaat
atcattgatggcagattgcctgaagttatgcttcctgtgtggttcactaataacttggat
gtggtttcatcatacgtccaagaccagagtgaagactgtctatacttaaacatctatgtc
ccaactgaagatggtccccttacaaagaaacacacagatgatttaggtgataatgacggt
gctgaagatgaagatattcgggacagtgggggtcccaaaccagtgatggtgtacatccat
ggcggctcttacatggaaggtactggaaatctgtatgatgggagtgtcttggcaagctat
ggcaatgtgatcgtcatcacagtcaactatcggcttggggtacttggcttcttgagcaca
ggggatcaggctgccaaaggaaactacgggctccttgacctcatccaggccctaagatgg
accagcgagaacattgggttctttggtggtgaccccttgcgaatcactgtgtttggatca
ggcgctgggggttcatgtgtcaacctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcagagtggaacagccctt
tccagctgggctgttagtttccagcctgcaaaatacgctagaattctggccacaaaagtt
ggctgcaatgtttcagatacagtagagttagtagaatgcctgcagaagaagccttacaaa
gaacttgttgatcaagatgttcaaccagcccgataccacatagcctttggacctgtgatc
gatggtgatgtaataccagatgaccctcagatactgatggaacaaggagagttcctcaac
tatgatataatgttgggagttaaccaaggggaagggttgaagtttgtcgaaaatatagta
gatagtgatgatggtgtatcagccagtgatttcgactttgctgtttctaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaaattcatgtat
actgactgggctgatcgccataatcctgaaactagaaggaagacattgttggctttgttt
acggaccatcaatgggtagcacctgctgtggccacagcagaccttcactcgaactttggc
tcacctacatacttctatgccttttatcatcattgccaaacagatcaagttccagcttgg
gctgatgcagctcatggggatgaggttccctatgtgttgggaatccccatgattggccct
acagagttatttccttgcaatttctccaagaatgatgtgatgttgagtgcagtagtaatg
acatactggacgaattttgctaaaactggtgacccaaatcaaccagttcctcaagacaca
aaattcatccataccaaacccaaccgctttgaagaagtagcatggaccagatattcccag
aaagaccagctttatctccatattggattaaaaccgagagttaaagagcattacagagcc
aataaggtaaatctctggctggagctggtacctcatctgcataatctcaatgacatttct
cagtatacctcgacaacaactaaagtgccatccacggacatcactctcagacctacaagg
aagaattccacaccagtcacatcagcctttcccactgccaaacaggatgatcccaagcaa
caaccaagccccttctcggtggatcagagggactactccacagagctaagtgtcactatc
gcagtgggggcctctctgctgtttctcaacatcttggcttttgcagccctgtactacaag
aaggataagaggagacatgatgtccaccggaggtgcagccctcagcgcacgaccaccaac
gacctaacccatgctccagaagaggaaattatgtctctccaaatgaagcacactgacttg
gatcacgagtgtgagtccatccatccacatgaggtggttcttcggaccgcctgtccccca
gattatactctagctatgaggaggtcacctgatgatattccactaatgacacctaacacc
atcacaatgattcccaacactataccagggattcagcccttacatacattcaacacattt
actggaggacagaataatacactgccccatccccacccacacccccattcacattcaaca
accagggtatag

KEGG   Mus musculus (house mouse): 216856
Entry
216856            CDS       T01002                                 
Symbol
Nlgn2, NL2, NLG2
Name
(RefSeq) neuroligin 2
  KO
K07378  neuroligin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    216856 (Nlgn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216856 (Nlgn2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    216856 (Nlgn2)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE Peptidase_S9
Other DBs
NCBI-GeneID: 216856
NCBI-ProteinID: NP_942562
MGI: 2681835
Ensembl: ENSMUSG00000051790
UniProt: Q69ZK9 Q6PHN2
Structure
LinkDB
Position
11:complement(69713949..69728610)
AA seq 836 aa
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRTPGPGTSGTRRPPPPATLPPESDIDLGP
RAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSG
SGVPGGGPLLPTAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDD
VPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgtggctcctggcgttgtgtctggtggggctggctggggctcaacggggaggagggggt
cccggcggcggcgccccgggcggcccaggcctgggcctcggcagcctcggggaggagcgc
ttccccgtggtgaacacagcctacgggcgagtgcgcggtgtgcggcgcgagctcaacaac
gagatcctgggcccggtcgtgcagttcttgggcgtgccctacgccacgccgcccttgggc
gcccgccgcttccagccgcctgaggcacctgcctcgtggcccggcgtgcgcaacgccacc
accctgccgcccgcctgcccgcagaacctgcacggggccctgccggccatcatgctgcct
gtgtggttcaccgacaacttggaggcggccgccacctacgtgcagaaccagagcgaggac
tgcctgtacctcaacctctacgtgcccactgaggacggtccgctcacaaaaaaacgtgac
gaggcgacgctcaatccgccagacacagatatccgggactctgggaagaaaccggtcatg
ctgtttctacacggcggctcctacatggaaggcaccgggaacatgtttgacggctcagtc
ctggctgcctatggcaatgtcatcgtagtcacactcaactaccgtcttggggtgctcggt
tttctcagcactggtgaccaggctgcaaaaggcaactatgggctcctggaccagatccag
gccctgcgctggctcagtgaaaacattgcccactttggaggtgaccctgaacgcatcact
atctttgggtctggtgcaggggcctcctgtgtcaacttgctgatcctttcccaccactca
gaaggactgttccagaaggccattgctcaaagtggtactgccatttccagctggtctgtc
aactaccagccgctcaagtacacgcggctgctggcggccaaagtgggctgtgaccgagaa
gacagcactgaagctgtggagtgtctgcgccggaagtcttcccgggagctagtggaccag
gatgtacagcctgcccgctaccacattgcctttgggcctgtggtggacggcgacgtagtc
cctgatgaccccgagatcctcatgcaacagggggaattcctcaactacgacatgctcatt
ggtgtcaaccagggagagggtctcaagttcgtggaggactctgcagagagtgaggacggt
gtgtctgccagcgcctttgacttcaccgtctccaactttgtggacaacttgtacgggtac
ccagaaggcaaggacgtgcttcgagagaccatcaagttcatgtacacggactgggctgac
agggacaatggcgagatgcggcggaagaccctgctggcgctctttaccgaccaccagtgg
gtcgccccggctgtggccaccgccaagctgcatgccgactaccagtcccccgtctacttt
tacactttctaccaccactgccaggcagagggccggccagagtgggcagacgcagcgcac
ggggacgagctgccctacgtctttggtgtccccatggtgggcgccactgacctcttcccc
tgcaacttctccaagaacgatgtcatgctcagcgcagtagtcatgacctattggaccaac
ttcgccaagactggtgaccccaaccagcctgtgccacaggacaccaagttcatccacacc
aagcccaaccgctttgaagaggtagtgtggagcaagttcaacagcaaggaaaagcagtat
ctgcacataggcttgaaaccacgcgtgcgcgacaactaccgtgccaacaaggtggccttc
tggctggagctcgtgccccacctgcacaacctgcacacagagctcttcaccaccaccact
cgcctgcctccctatgccacacgctggccacctcgcacacctggtcctggcacttccggc
acacgccgtcctcccccacctgccactctgccacctgagtctgatattgacctaggccca
agggcctatgaccgcttccccggtgactcgagggactactccacggagctaagcgtgact
gtggcagtgggtgcctccctcctcttcctcaacatccttgcctttgccgccctctattac
aagcgggaccggcgccaggagctgcggtgccggaggcttagcccaccaggaggctcaggc
tcaggtgtgcctggtgggggccccctgcttcccactgctggccgtgagctacccccggag
gaggagctagtatcgctgcagctgaagcggggtggtggtgttggggcggaccctgctgag
gccctgcgccctgcctgtccacccgactataccctggccttgcgccgggcaccggacgat
gtgcctctcttggcccccggggccctaaccctgctgcctagtggcctggggcccccgccc
ccgcccccacccccttctctccatccctttgggcccttcccacccccaccccctactgct
accagccacaacaacacgctaccccatccccactccaccactcgggtatag

KEGG   Mus musculus (house mouse): 245537
Entry
245537            CDS       T01002                                 
Symbol
Nlgn3, A230085M13Rik, HNL3, NL3, NLG3
Name
(RefSeq) neuroligin 3
  KO
K07378  neuroligin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    245537 (Nlgn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    245537 (Nlgn3)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    245537 (Nlgn3)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 245537
NCBI-ProteinID: NP_766520
MGI: 2444609
Ensembl: ENSMUSG00000031302
UniProt: Q8BYM5
Structure
LinkDB
Position
X:100342785..100364956
AA seq 825 aa
MWLQPSLSLSPTPTVGRSLCLTLGFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEIL
GPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWF
TANLDIVATYIQEPNEDCLYLNVYVPTEDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVM
VYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAV
NYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARYHVAFGPVIDGDVI
PDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGY
PEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYF
YAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVAF
WKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENA
PGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLFLNVLAFAALYYRKDKRRQEPLRQ
PSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGPPHDTLRLTALPDYTLTLRRSPDDI
PLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLPHSHSTTRV
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgtggctgcagccctcgctgtccctgagccccacgcccacagttggccggagcctgtgc
ctcaccctgggcttcctcagtttggtgctgagggccagtacccaggccccggcacccaca
gtcaatactcactttgggaagctaaggggtgccagagtaccattgcccagtgaaatcctg
ggtcctgtggaccaatacctgggggtaccctacgcagctcccccgatcggcgagaaacgt
ttcctgccccctgaaccacccccatcctggtcgggcatccggaacgccacacactttccc
ccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgctgccagtctggttc
actgccaacttggatatcgtcgccacttatatccaggagcccaacgaagattgcctctat
ctgaatgtgtatgtgcccacggaagatggatccggcgctaagaaacagggcgaggactta
gcggataatgacggggatgaagatgaagacatccgagacagtggtgctaaacctgtcatg
gtctacatccacggaggctcttacatggaaggaacaggcaacatgattgatggcagtgtt
cttgcaagttacggcaacgtcatcgtcatcaccctcaactatcgggtcggggtgctaggt
ttcctgagcactggagatcaggctgccaagggcaactatgggctccttgatcaaatccag
gcccttcgctgggtgagtgagaatattgccttctttggaggagatccccgtagaattact
gtctttggctctggcatcggtgcatcctgtgtcagtctccttacactgtctcatcattct
gaggggcttttccagagggccatcatccaaagtggctctgctctatctagctgggctgtg
aactaccaaccagtgaagtataccagcttgctggcagacaaagtgggctgtaacgtcctg
gacactgtggatatggtggattgtcttcgacaaaagagtgccaaggagctggtagaacag
gacattcagccagcccgctaccatgtggcttttggccctgtgattgatggtgatgtcatt
cctgatgaccctgagatccttatggagcagggagagttcctcaactatgatatcatgcta
ggcgtcaaccagggtgagggtctcaagtttgtggaaggggtggtggaccccgaggatggt
gtctcgggcactgactttgactactctgtctccaattttgtggacaatctgtatggctat
cctgagggtaaggacaccctgcgggagactatcaagttcatgtatacggactgggcagac
cgagacaaccctgagacccgccgtaaaacactggtggcactcttcactgaccaccagtgg
gtggagccttcagtggtgacagccgatctgcacgcccgctatggctcacctacctacttc
tacgccttctaccatcactgccagagcctcatgaagcccgcatggtcagatgcagcacac
ggggatgaagtgccctatgtttttggtgtccctatggtaggtcccactgaccttttcccc
tgcaacttctccaagaatgatgttatgctcagtgctgtcgtcatgacctattggaccaac
tttgccaagaccggggatcccaacaagccggtaccccaggataccaagttcattcacacc
aaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagaccagctctac
cttcacatcgggctgaaaccaagggttcgtgatcattaccgggccacaaaggtagccttt
tggaaacacctggtgccccacctgtacaacctgcatgacatgttccactatacatccacg
accaccaaagtgccgcccccggacaccacccacagctcccacatcacccgtaggcccaac
ggcaagacctggagcaccaagcggccggcgatttcacctgcctacagcaatgagaatgcc
cctgggtcctggaatggggaccaggatgcggggccactcctggttgagaaccctcgagac
tactccactgaattaagtgtcactatcgctgtgggggcctccctcctgtttctcaatgtg
ttggcctttgctgccctctattaccgtaaggacaaacggcgccaggagcccctgaggcag
cctagcccccaaaggggaactggtgcccctgaattgggaactgctccggaggaggagctg
gcagcattacagttgggtcccactcaccatgaatgtgaggccggtcccccacatgacaca
cttcgcctcacagcactgcccgactataccctgaccctgcggcgctcccctgatgacatc
ccactcatgactcccaacaccatcactatgattcctaattccctggttgggttgcagacc
ttgcacccctataacacctttgccgcagggttcaacagtactgggctgccccactcacac
tccactacccgtgtatag

DBGET integrated database retrieval system