KEGG   Mus musculus (house mouse): 19883
Entry
19883             CDS       T01002                                 
Symbol
Rora, 9530021D13Rik, Nr1f1, ROR1, ROR2, ROR3, nmf267, sg, staggerer, tmgc26
Name
(RefSeq) RAR-related orphan receptor alpha
  KO
K08532  RAR-related orphan receptor alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04659  Th17 cell differentiation
mmu04710  Circadian rhythm
mmu05017  Spinocerebellar ataxia
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    19883 (Rora)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19883 (Rora)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    19883 (Rora)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    19883 (Rora)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19883 (Rora)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19883 (Rora)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    19883 (Rora)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   19883 (Rora)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 19883
NCBI-ProteinID: NP_038674
MGI: 104661
Ensembl: ENSMUSG00000032238
UniProt: P51448 Q8C3F5
LinkDB
Position
9:68560627..69295528
AA seq 523 aa
MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSYASSSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgaaccgggcagcagcggctcg
gaggcggccgcgggctccagggagaccccgctgacccaggacacgggccgcaagagcgag
gcaccgggcgcggggcgcaggcagagctatgcgagctccagccgaggtatctcagtcacg
aagaagacacacacatctcaaattgaaattattccatgcaagatctgtggagacaaatcg
tcaggaatccattatggtgtcattacgtgtgaaggctgcaagggctttttcaggagaagt
cagcagagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcggacc
agcagaaaccgctgccagcattgtcggctgcagaaatgcctggccgtggggatgtctcga
gatgctgtcaagtttggtcggatgtccaagaagcagagagacagcttgtacgccgaggtg
cagaagcaccggatgcagcagcagcagcgagaccaccagcagcagcctggggaggcggag
ccgctgacgcccacctacaacatctcagccaatgggctgacggaactgcatgatgacctc
agcacctatatggatgggcacacccccgagggcagcaaggccgactcagccgtcagcagc
ttctacctggacatccagccctccccagaccagtcgggattggacatcaatgggatcaaa
cccgaacccatatgtgactacacaccagcatctggcttcttcccctactgttccttcacc
aacggagagacttccccaaccgtgtccatggcagaactagaacaccttgcccagaacata
tccaaatcccacctggaaacctgccagtacttgcgggaagagctccagcagataacgtgg
cagaccttcctgcaggaggagattgaaaactaccagaacaagcagagagaggtgatgtgg
cagctgtgtgccatcaagattacagaagctatccagtatgtggtggagtttgccaaacgc
attgatggatttatggagctgtgtcaaaatgatcaaattgtgcttctaaaagcaggctcg
ctagaggtggtgtttattaggatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgacgggaagtatgcgagccccgatgtcttcaagtccctaggttgtgaagacttcatc
agctttgtgtttgaatttgggaagagtttgtgttctatgcacctgaccgaagacgaaatc
gcgttattttctgcattcgtactgatgtcagcggatcgctcgtggcttcaggaaaaggta
aaaatagaaaagctgcaacagaaaattcagctggcccttcagcacgtcctacagaagaac
caccgagaagatggaattctaaccaagctaatatgcaaggtgtctacgttaagagcccta
tgtggacgacatacggaaaagctaatggcatttaaagcaatatacccagacattgtgcga
ctccattttcctccattatacaaggaattgttcacttcagaatttgagccagccatgcaa
atcgatgggtaa

KEGG   Mus musculus (house mouse): 19885
Entry
19885             CDS       T01002                                 
Symbol
Rorc, Nr1f3, RORgamma, TOR, Thor
Name
(RefSeq) RAR-related orphan receptor gamma
  KO
K08534  RAR-related orphan receptor gamma
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04659  Th17 cell differentiation
mmu04710  Circadian rhythm
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    19885 (Rorc)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19885 (Rorc)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    19885 (Rorc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19885 (Rorc)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19885 (Rorc)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    19885 (Rorc)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   19885 (Rorc)
SSDB
Motif
Pfam: zf-C4 Hormone_recep Emfourin
Other DBs
NCBI-GeneID: 19885
NCBI-ProteinID: NP_035411
MGI: 104856
Ensembl: ENSMUSG00000028150
UniProt: P51450 A0A0R4J096
LinkDB
Position
3:94280101..94305583
AA seq 516 aa
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELG
EPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLKAGAMEVVL
VRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTA
LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEK
LQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacaccaccggacatctcgggagctgctggctgcaaagaag
acccacacctcacaaattgaagtgatcccttgcaagatctgtggggacaagtcatctggg
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccgcagccagcag
tgtaatgtggcctactcctgcacgcgtcagcagaactgccccattgaccgaaccagccgc
aaccgatgccagcattgccgcctgcagaagtgcctggctctgggcatgtcccgagatgct
gtcaagtttggccgaatgtccaagaagcagagggacagtctacatgcagaagtgcagaaa
caactgcaacagcagcagcaacaggaacaagtggccaagactcctccagctgggagccgc
ggagcagacacacttacatacactttagggctctcagatgggcagctaccactgggcgcc
tcacctgacctacccgaggcctctgcttgtccccctggcctcctgagagcctcaggctct
ggcccaccatattccaataccttggccaaaacagaggtccagggggcctcctgccacctt
gagtatagtccagaacgaggcaaagctgaaggcagagacagcatctatagcactgacggc
caacttactcttggaagatgtggacttcgttttgaggaaaccaggcatcctgaacttggg
gaaccagaacagggtccagacagccactgcattcccagtttctgcagtgccccagaggta
ccatatgcctctctgacagacatagagtacctggtacagaatgtctgcaagtccttccga
gagacatgccagctgcgactggaggaccttctacggcagcgcaccaacctcttttcacgg
gaggaggtgaccagctaccagaggaagtcaatgtgggagatgtgggagcgctgtgcccac
cacctcactgaggccattcagtatgtggtggagtttgccaagcggctttcaggcttcatg
gagctctgccagaatgaccagatcatactactgaaagcaggagcaatggaagtcgtccta
gtcagaatgtgcagggcctacaatgccaacaaccacacagtcttttttgaaggcaaatac
ggtggtgtggagctgtttcgagccttgggctgcagcgagctcatcagctccatatttgac
ttttcccacttcctcagcgccctgtgtttttctgaggatgagattgccctctacacggcc
ctggttctcatcaatgccaaccgtcctgggctccaagagaagaggagagtggaacatctg
caatacaatttggaactggctttccatcatcatctctgcaagactcatcgacaaggcctc
ctagccaagctgccacccaaaggaaaactccggagcctgtgcagccaacatgtggaaaag
ctgcagatcttccagcacctccaccccatcgtggtccaagccgccttccctccactctat
aaggaactcttcagcactgatgttgaatcccctgaggggctgtcaaagtga

KEGG   Mus musculus (house mouse): 225998
Entry
225998            CDS       T01002                                 
Symbol
Rorb, Nr1f2, RZR-beta, RZRB, Rorbeta, hstp
Name
(RefSeq) RAR-related orphan receptor beta
  KO
K08533  RAR-related orphan receptor beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    225998 (Rorb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    225998 (Rorb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    225998 (Rorb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    225998 (Rorb)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   225998 (Rorb)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 225998
NCBI-ProteinID: NP_666207
MGI: 1343464
Ensembl: ENSMUSG00000036192
UniProt: Q8R1B8
LinkDB
Position
19:complement(18907966..19088560)
AA seq 470 aa
MCENQPKTKADGTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNTETGGTYANGHVIDLPKSEGYYSIDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMSEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCAAVCK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtgtgagaaccagcccaaaactaaagctgacggcactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataaatcctccgggatccactacggagtcatcacgtgtgaaggc
tgcaagggattcttcaggaggagccagcagaacaatgcctcttactcctgcccaaggcag
agaaactgtttaattgacagaaccaacaggaaccgttgccaacactgccgcctgcagaag
tgtcttgccctaggaatgtcaagagatgctgtaaagttcgggaggatgtccaagaagcag
cgggacagcctgtatgctgaggtgcagaagcatcagcaaaggctgcaggagcagcggcag
cagcagagtggggaggcggaggccctcgccagggtgtacagcagcagcattagcaatggc
ctcagcaacctgaacaccgagaccggcggcacatacgccaacgggcacgtcattgacctg
cccaagtccgaaggttattacagcatagattccggtcagccgtctcccgatcagtcagga
ctggacatgactgggatcaaacagataaagcaagaacctatctatgacctcacatctgta
cccaacttgtttacctatagctctttcaacaacgggcagttagctcccgggataacaatg
tctgagatcgatcgaattgcacagaacatcattaagtcccatttggagacatgtcagtac
accatggaagaactccatcagctggcatggcagacccacacctacgaggaaatcaaggcg
tatcaaagcaagtccagggaggctctgtggcagcagtgtgccatccagatcacccatgct
atccagtacgtggtggagttcgccaagcggataacaggcttcatggagctgtgtcagaac
gatcagatcttacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgtcgt
gccttcaacccattaaacaacactgttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaagccttaggttcggatgacctagtgaatgaagcatttgactttgcgaagaatctg
tgttccttgcagctgactgaggaagagattgctctgttctcctctgctgttctgatatcc
ccagaccgagcctggctgatcgaaccaagaaaagtccagaagcttcaggaaaagatttat
tttgcactgcaacatgtgattcagaagaaccacctggatgatgagaccctggcaaagtta
atagccaagataccaactatcacggcagtctgcaacttgcatggggagaagctgcaggta
tttaagcagtctcatccagacatagtgaatacactgtttcctccattgtacaaggagctc
tttaatcctgactgtgctgcggtctgcaaatga

DBGET integrated database retrieval system