KEGG   Mus musculus (house mouse): 20312
Entry
20312             CDS       T01002                                 
Symbol
Cx3cl1, AB030188, ABCD-3, AI848747, CX3C, Cxc3, D8Bwg0439e, FK, Scyd1
Name
(RefSeq) chemokine (C-X3-C motif) ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04668  TNF signaling pathway
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20312 (Cx3cl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20312 (Cx3cl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20312 (Cx3cl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    20312 (Cx3cl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    20312 (Cx3cl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20312 (Cx3cl1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20312 (Cx3cl1)
SSDB
Motif
Pfam: IL8 CCDC84
Other DBs
NCBI-GeneID: 20312
NCBI-ProteinID: NP_033168
MGI: 1097153
Ensembl: ENSMUSG00000031778
UniProt: O35188
LinkDB
Position
8:95498808..95509055
AA seq 395 aa
MAPSPLAWLLRLAAFFHLCTLLPGQHLGMTKCEIMCDKMTSRIPVALLIRYQLNQESCGK
RAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNGGKFEKRVDNVTPGITLATRG
LSPSALTKPESATLEDLALELTTISQEARGTMGTSQEPPAAVTGSSLSTSEAQDAGLTAK
PQSIGSFEAADISTTVWPSPAVYQSGSSSWAEEKATESPSTTAPSPQVSTTSPSTPEENV
GSEGQPPWVQGQDLSPEKSLGSEEINPVHTDNFQERGPGNTVHPSVAPISSEETPSPELV
ASGSQAPKIEEPIHATADPQKLSVLITPVPDTQAATRRQAVGLLAFLGLLFCLGVAMFAY
QSLQGCPRKMAGEMVEGLRYVPRSCGSNSYVLVPV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctccctcgccgctcgcgtggctgctgcgcctggccgcgttcttccatttgtgtact
ctgctgccgggtcagcacctcggcatgacgaaatgcgaaatcatgtgcgacaagatgacc
tcacgaatcccagtggctttgctcatccgctatcagctaaaccaggagtcctgcggcaag
cgtgccattgtcctggagacgacacagcacagacgcttctgtgctgacccgaaggagaaa
tgggtccaagacgccatgaagcatctggatcaccaggctgctgccctcactaaaaatggt
ggcaagtttgagaagcgggtggacaatgtgacacctgggatcaccttggccactagggga
ctgtccccatctgccctgacaaagcctgaatccgccacattggaagaccttgctttggaa
ctgactactatttcccaggaggccagggggaccatggggacttcccaagagccaccggca
gcagtgaccggatcatctctctcaacttccgaggcacaggatgcagggcttacggctaag
cctcagagcattggaagttttgaggcggctgacatctccaccaccgtttggccgagtcct
gctgtctaccaatctggatctagctcctgggctgaggaaaaagctactgagtccccctcc
actacagccccatctcctcaggtgtccactacttcaccttcaaccccagaggaaaatgtt
gggtccgaaggccaacccccatgggtccagggacaggacctcagtccagagaagtctcta
gggtctgaggagataaacccagttcatactgataatttccaggagagggggcctggcaac
acagtccacccctcagtggctcccatctcctctgaagagacccccagcccagagctggtg
gcctcgggcagccaggctcctaagatagaggaacccatccatgccactgcagatccccag
aaactgagtgtgcttatcactcctgtccccgacacccaggcagccacaaggaggcaggca
gtggggctactggctttccttggtcttcttttctgcctaggggtggccatgtttgcttac
cagagccttcagggctgtccccgcaaaatggcgggggaaatggtagaaggcctccgctac
gtcccccgtagctgtggcagtaactcatacgtcctggtgccagtgtga

DBGET integrated database retrieval system