KEGG   Mus musculus (house mouse): 20339
Entry
20339             CDS       T01002                                 
Symbol
Sele, CD62E, E-selectin, ELAM-1, Elam, LECAM2
Name
(RefSeq) selectin, endothelial cell
  KO
K06494  selectin, endothelial cell
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04668  TNF signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20339 (Sele)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    20339 (Sele)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    20339 (Sele)
   05143 African trypanosomiasis
    20339 (Sele)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20339 (Sele)
   05418 Fluid shear stress and atherosclerosis
    20339 (Sele)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20339 (Sele)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    20339 (Sele)
   04090 CD molecules [BR:mmu04090]
    20339 (Sele)
   04091 Lectins [BR:mmu04091]
    20339 (Sele)
Cell adhesion molecules [BR:mmu04515]
 Selectins
  Selectin family
   20339 (Sele)
CD molecules [BR:mmu04090]
 Proteins
  20339 (Sele)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 4: Selectins
   20339 (Sele)
SSDB
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 EGF_3
Other DBs
NCBI-GeneID: 20339
NCBI-ProteinID: NP_035475
MGI: 98278
Ensembl: ENSMUSG00000026582
Vega: OTTMUSG00000050836
UniProt: Q00690 Q3U5F6
LinkDB
Position
1:163867200..163886056
AA seq 619 aa
MKATAGVMNASRFLSALVFVLLAGESTAWYYNASSELMTYDEASAYCQRDYTHLVAIQNK
EEINYLNSNLKHSPSYYWIGIRKVNNVWIWVGTGKPLTEEAQNWAPGEPNNKQRNEDCVE
IYIQRTKDSGMWNDERCNKKKLALCYTASCTNASCSGHGECIETINSYTCKCHPGFLGPN
CEQAVTCKPQEHPDYGSLNCSHPFGPFSYNSSCSFGCKRGYLPSSMETTVRCTSSGEWSA
PAPACHVVECEALTHPAHGIRKCSSNPGSYPWNTTCTFDCVEGYRRVGAQNLQCTSSGIW
DNETPSCKAVTCDAIPQPQNGFVSCSHSTAGELAFKSSCNFTCEQSFTLQGPAQVECSAQ
GQWTPQIPVCKAVQCEALSAPQQGNMKCLPSASGPFQNGSSCEFSCEEGFELKGSRRLQC
GPRGEWDSKKPTCSAVKCDDVPRPQNGVMECAHATTGEFTYKSSCAFQCNEGFSLHGSAQ
LECTSQGKWTQEVPSCQVVQCPSLDVPGKMNMSCSGTAVFGTVCEFTCPDDWTLNGSAVL
TCGATGRWSGMPPTCEAPVSPTRPLVVALSAAGTSLLTSSSLLYLLMRYFRKKAKKFVPA
SSCQSLQSFENYHVPSYNV
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaaagcaactgctggagtcatgaatgcctcgcgctttctctctgctcttgtttttgtt
ctcctcgctggagagagcacagcttggtactacaatgcctccagtgagctcatgacgtat
gatgaagccagtgcatactgtcagcgggactacacacatctggtggcaattcagaacaag
gaagagatcaactaccttaactccaatctgaaacattcaccgagttactactggattgga
atcagaaaagtcaataacgtatggatctgggtggggacggggaagcctctgacagaggaa
gctcagaactgggctccaggtgaaccaaacaacaaacaaagaaatgaggactgtgtagag
atttacatccaacgaaccaaagactcgggcatgtggaatgacgagagatgtaacaaaaag
aagctggctctgtgctacacagcttcgtgtaccaatgcatcctgcagtggtcatggtgaa
tgcatagagaccatcaatagttacacctgcaagtgccaccctggcttcctgggacccaac
tgtgagcaagctgtgacttgcaaaccacaggaacaccctgactatggaagcctgaactgc
tcccacccgttcggccccttcagctataattcctcctgctcctttggctgtaaaaggggc
tacctgcccagcagcatggagaccaccgtgcggtgtacgtcctctggagagtggagtgcg
cctgctccagcctgccatgtggttgaatgtgaagctttgacccaccctgcccacggtatc
aggaaatgttcctcaaatcctgggagctacccatggaacacgacatgcacgtttgactgt
gtggaagggtacaggcgagttggagctcagaatctacagtgtacctcatctggcatctgg
gataacgagacgccatcatgcaaagctgtgacctgtgacgccatccctcagcctcagaat
ggctttgtgagctgcagccactcaacagctggagaacttgcgtttaagtcatcctgtaac
ttcacctgtgagcagagtttcacgttgcaggggccagcgcaggttgaatgcagcgcacaa
gggcagtggacaccacaaatcccagtctgcaaagctgtccagtgtgaagccttatctgcg
ccacagcagggcaacatgaaatgtcttcccagtgcttctggacctttccaaaatgggtcc
agttgtgagttctcctgcgaagaaggatttgaactgaagggatcaagaagacttcagtgt
ggtccaagaggggaatgggatagcaagaagcccacgtgttcagctgtgaaatgtgatgat
gtccctcggccccagaatggcgtcatggagtgtgctcatgctactactggagaattcacc
tacaagtcctcatgtgcctttcaatgcaatgagggctttagcttgcatggctcagctcaa
cttgagtgcacatctcagggaaagtggacccaggaagtcccctcctgccaagtggtacaa
tgtccaagccttgacgtcccgggaaagatgaacatgagctgcagcggaacagcagttttc
ggcacagtgtgtgagtttacatgtcctgatgattggacactcaatggatctgcagttctg
acgtgtggtgccacgggacgctggtctgggatgccgcctacctgtgaagccccagtcagc
cccacccgtcccttggtagttgcactttctgcggcaggaacctcactcctgacatcgtcc
tcattgctctacttgttgatgagatactttcggaagaaagcaaagaaatttgttcctgct
agcagctgccaaagccttcaatcgtttgaaaactaccatgtgccttcttacaacgtctag

DBGET integrated database retrieval system