KEGG   Mus musculus (house mouse): 20340
Entry
20340             CDS       T01002                                 
Symbol
Glg1, AI593353, AW537898, CFR, CFR-1, ESL-1, MG-160, MG160, Selel
Name
(RefSeq) golgi apparatus protein 1
  KO
K06816  golgi apparatus protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    20340 (Glg1)
SSDB
Motif
Pfam: Cys_rich_FGFR THDPS_N_2
Other DBs
NCBI-GeneID: 20340
NCBI-ProteinID: NP_033175
MGI: 104967
Ensembl: ENSMUSG00000003316
UniProt: Q61543 Q53WR6
LinkDB
Position
8:complement(111879916..111985842)
AA seq 1175 aa
MAVCGRVRGMFRLSAALPLLLLAAAGAQNGHGQGQGPGTNFGPFPGQGGGGSPAGQQPPQ
QPQLSQQQQQPPPQQQQQQQQQSLFAAGGLPARRGGAGPGGTGGGWKLAEEESCREDVTR
VCPKHTWSNNLAVLECLQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVCKSTI
SEIKECAEEPVGKGYMVSCLVDHRGNITEYQCHQYITKMTAIIFSDYRLICGFMDDCKND
INLLKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEEKEPKIQVSELCKKAILRVAELSSD
DFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEKCREALTTRQKLIAQ
DYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQGEML
DYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNCQQAL
QTLIQETDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVEDCEH
RLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSELMPPGAVFSCLYRHAYRTE
EQGRRLSRECRAEVQRILHQRAMDVKLDPALQDKCLIDLGKWCSEKTETGQELECLQDHL
DDLAVECRDIVGNLTELESEDIQIEALLMRACEPIIQNFCHDVADNQIDSGDLMECLIQN
KHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNIKKKVDVVICLSTTV
RNDTLQEAKEHRVSLKCRKQLRVEELEMTEDIRLEPDLYEACKSDIKNYCSTVQYGNAQI
IECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTMLQCL
KQNKNSELMDPKCKQMITKRQITQNTDYRLNPVLRKACKADIPKFCHGILTKAKDDSELE
GQVISCLKLRYADQRLSSDCEDQIRIIIQESALDYRLDPQLQLHCSDEIANLCAEEAAAQ
EQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITP
GRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSK
NYILSVISGSICILFLIGLMCGRITKRVTRELKDR
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggcggtgtgtggacgtgtacgggggatgttccgcttgtcggcggcgttgccgctgctg
ctgctcgcggcagcaggggcccagaatggtcacggtcagggccagggtccggggaccaac
tttgggcccttcccagggcaaggtggaggcggcagcccggccggccaacagccgcctcag
cagcctcagttatcgcagcagcagcagcagccgccgcctcagcagcagcagcagcaacag
cagcagtcgcttttcgcggcgggcgggctcccggcccggcggggcggagcggggcccggt
gggactggcggaggctggaagctggcggaggaagagtcctgccgggaggacgtgacccgt
gtgtgccccaaacacacctggagcaacaacctggcggtgctcgagtgcctgcaggacgtg
agggagcccgagaacgagatttcttcagactgcaatcatttgttgtggaattacaagctg
aacctgactactgatcccaaatttgaatctgtggccagggaggtttgcaagtcaactatt
tccgagattaaagaatgtgcggaagaaccagttggaaaaggttacatggtttcctgcttg
gtggatcatcgaggcaacatcactgagtatcagtgtcatcaatacattaccaagatgacg
gccatcattttcagtgattatcgcttgatctgcggcttcatggatgactgcaaaaatgat
atcaacctcttgaaatgtggcagcattcgtcttggggaaaaggatgcacattcacaaggt
gaggtggtatcatgtttggaaaaaggcctggtaaaagaggcagaagaaaaagagccgaag
attcaagtctcagaactctgcaagaaagccattcttagggtggctgagctgtcctcggat
gactttcatttagaccggcatttgtattttgcttgccgagatgatcgggagcgcttttgc
gagaatacacaagctggtgaaggaagagtgtataaatgcctatttaaccataagtttgaa
gaatccatgagtgaaaagtgtagagaagcactaactacacgccagaagctcattgcccag
gattataaagtcagttactcattagccaaatcctgtaagagtgacttgaaaaaataccgg
tgcaatgtggaaaaccttcctcggtcccgggaagccaggctctcctaccttctgatgtgc
ctggagtcagcagtgcacagagggcggcaggtgagcagtgagtgccaaggtgagatgctg
gattaccgacgcatgctgatggaagacttctctctgagccccgagatcatcctgagctgt
cgaggggagattgaacaccattgttctggattacatcggaaagggcgaaccctccactgt
ctgatgaaagtggttcggggtgaaaaggggaaccttggaatgaactgccaacaggcgctt
cagacactgattcaggagactgaccctggtgcagactaccgcattgatcgagctttgaat
gaagcttgtgagtctgtaatacagacagcctgcaaacacatacgatccggagacccaatg
attctctcatgtctgatggagcatttatacacagagaagatggtggaagactgtgaacac
cggctcttagagctacagtattttatctctcgggattggaagttggaccctgttttatac
cgaaaatgccagggagatgcttcccgcctttgccatacccatggttggaatgagaccagt
gaacttatgccccctggagctgtgttttcttgcctatacagacatgcctaccgcacagaa
gagcaaggaaggaggctctcacgagaatgtcgagctgaagtccagaggatcctgcaccag
cgagccatggatgttaagctggatcctgccctccaggacaagtgcctcatagacctaggg
aagtggtgcagtgagaagacggagactgggcaggagcttgagtgccttcaggaccatctc
gatgacttagctgtggaatgcagagacatcgtgggcaacctcaccgagttagagtccgag
gatatacaaatagaagctttgctgatgagagcctgtgagcctatcattcagaacttttgc
cacgatgtggcagacaaccagatcgactctggggacctgatggagtgtctgatccagaac
aagcaccagaaggacatgaacgagaagtgtgccattggcgtcactcacttccagctggta
cagatgaaggattttcgattctcttacaagttcaaaatggcctgcaaggaggatgtgtta
aagctttgccccaacataaaaaagaaggtggacgtagtgatctgcctgagcaccactgtg
cgcaacgacactctgcaggaggccaaggagcaccgagtatcactcaagtgccgcaagcag
cttcgtgtggaagagctggagatgacagaggacatccgtttggaaccagatctgtatgaa
gcctgcaagagtgacatcaagaactactgttctacagtgcaatatggaaatgctcagatt
attgaatgtctaaaagaaaacaagaagcagctgagtacccgttgccaccagaaagtattt
aagctgcaggagacggagatgatggacccagagctagactatactctgatgagagtctgc
aagcagatgattaagcggttctgtccagaagcagattctaaaactatgttgcagtgttta
aaacaaaataagaacagtgaattgatggatcccaaatgcaaacagatgataaccaagcgc
cagatcacccagaacacagattaccgcttaaaccctgtgctaaggaaggcctgtaaagct
gacattcctaagttctgtcatggcatcctgaccaaggctaaggacgattcagagctagaa
ggccaagttatctcatgcctcaagctgagatatgctgaccagcgcctgtcctcagactgt
gaggaccagatccgtatcatcatccaggagtctgctctggattaccgcctggaccctcag
ctccagctgcactgctcagatgagattgccaatctatgtgctgaagaagcagcagcccag
gagcaaacaggccaagtggaagagtgcctgaaggtcaacctgctcaagatcaagacagag
ctgtgtaaaaaggaagtgttaaacatgttgaaggaaagcaaagcagacatctttgtggac
cccgttcttcacacagcatgtgccttggacattaaacaccactgtgcagccatcacccct
ggccgcgggcgtcagatgtcctgcctgatggaggccctggaagataagcgagtgagattg
cagccagagtgcaaaaagcgcctcaatgaccggattgagatgtggagttatgcagccaag
gtggctccagcagatggcttctctgatcttgccatgcaagtgatgacatctccctcaaag
aactacatcctgtctgtgatcagcgggagcatctgcatactcttcctgattggcctgatg
tgtggacggatcaccaagagagtgacacgagagctgaaggacaggtag

DBGET integrated database retrieval system