KEGG   Mus musculus (house mouse): 20343
Entry
20343             CDS       T01002                                 
Symbol
Sell, AI528707, CD62L, L-selectin, LECAM-1, Lnhr, Ly-22, Ly-m22, Lyam-1, Lyam1
Name
(RefSeq) selectin, lymphocyte
  KO
K06495  selectin, lymphocyte
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    20343 (Sell)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    20343 (Sell)
   04090 CD molecules [BR:mmu04090]
    20343 (Sell)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20343 (Sell)
   04091 Lectins [BR:mmu04091]
    20343 (Sell)
Cell adhesion molecules [BR:mmu04515]
 Selectins
  Selectin family
   20343 (Sell)
CD molecules [BR:mmu04090]
 Proteins
  20343 (Sell)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   20343 (Sell)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 4: Selectins
   20343 (Sell)
SSDB
Motif
Pfam: Lectin_C Sushi EGF EGF_2 hEGF EGF_3
Other DBs
NCBI-GeneID: 20343
NCBI-ProteinID: NP_035476
MGI: 98279
Ensembl: ENSMUSG00000026581
UniProt: P18337 Q3UV83
LinkDB
Position
1:163889556..163908354
AA seq 372 aa
MVFPWRCEGTYWGSRNILKLWVWTLLCCDFLIHHGTHCWTYHYSEKPMNWENARKFCKQN
YTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPN
NKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTC
ICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQ
CGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAE
TQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKK
GKKSQERMDDPY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggtgtttccatggagatgtgagggtacttactggggctcgaggaacatcctgaagctg
tgggtctggacactgctctgttgtgacttcctgatacaccatggaactcactgttggact
taccattattctgaaaagcccatgaactgggaaaatgctagaaagttctgcaagcaaaat
tacacagatttagtcgccatacaaaacaagagagaaattgagtatttagagaatacattg
cccaaaagcccttattactactggataggaatcaggaaaattgggaaaatgtggacatgg
gtgggaaccaacaaaactctcactaaagaagcagagaactggggtgctggggagcccaac
aacaagaagtccaaggaggactgtgtggagatctatatcaagagggaacgagactctggg
aaatggaacgatgacgcctgtcacaaacgaaaggcagctctctgctacacagcctcttgc
cagccagggtcttgcaatggccgtggagaatgtgtggaaactatcaacaatcacacgtgc
atctgtgatgcagggtattacgggccccagtgtcagtatgtggtccagtgtgagcctttg
gaggcccctgagttgggtaccatggactgcatccaccccttgggaaacttcagcttccag
tccaagtgtgctttcaactgttctgagggaagagagctacttgggactgcagaaacacag
tgtggagcatctggaaactggtcatctccagagccaatctgccaagtggtccagtgtgag
cctttggaggcccctgagttgggtaccatggactgcatccaccccttgggaaacttcagc
ttccagtccaagtgtgctttcaactgttctgagggaagagagctacttgggactgcagaa
acacagtgtggagcatctggaaactggtcatctccagagccaatctgccaagagacaaac
agaagtttctcaaagatcaaagaaggtgactacaaccccctcttcattcctgtagccgtc
atggtcaccgcattctcggggctggcatttctcatttggctggcaaggcggttaaaaaaa
ggcaagaaatctcaagaaaggatggatgatccatactga

DBGET integrated database retrieval system