KEGG   Mus musculus (house mouse): 20750
Entry
20750             CDS       T01002                                 
Symbol
Spp1, 2AR, Apl-1, BNSP, BSPI, Bsp, ETA-1, Eta, OP, Opn, Opnl, Ric, Spp-1
Name
(RefSeq) secreted phosphoprotein 1
  KO
K06250  secreted phosphoprotein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04620  Toll-like receptor signaling pathway
mmu04929  GnRH secretion
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20750 (Spp1)
   04151 PI3K-Akt signaling pathway
    20750 (Spp1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    20750 (Spp1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    20750 (Spp1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20750 (Spp1)
  09152 Endocrine system
   04929 GnRH secretion
    20750 (Spp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    20750 (Spp1)
SSDB
Motif
Pfam: Osteopontin
Other DBs
NCBI-GeneID: 20750
NCBI-ProteinID: NP_001191162
MGI: 98389
Ensembl: ENSMUSG00000029304
UniProt: P10923 Q547B5
LinkDB
Position
5:104582977..104588919
AA seq 294 aa
MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAV
SSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDE
TVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKS
GESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDV
IDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN
NT seq 885 nt   +upstreamnt  +downstreamnt
atgagattggcagtgatttgcttttgcctgtttggcattgcctcctccctcccggtgaaa
gtgactgattctggcagctcagaggagaagctttacagcctgcacccagatcctatagcc
acatggctggtgcctgacccatctcagaagcagaatctccttgcgccacagaatgctgtg
tcctctgaagaaaaggatgactttaagcaagaaactcttccaagcaattccaatgaaagc
catgaccacatggacgacgatgatgacgatgatgatgacgatggagaccatgcagagagc
gaggattctgtggactcggatgaatctgacgaatctcaccattcggatgagtctgatgag
accgtcactgctagtacacaagcagacactttcactccaatcgtccctacagtcgatgtc
cccaacggccgaggtgatagcttggcttatggactgaggtcaaagtctaggagtttccag
gtttctgatgaacagtatcctgatgccacagatgaggacctcacctctcacatgaagagc
ggtgagtctaaggagtccctcgatgtcatccctgttgcccagcttctgagcatgccctct
gatcaggacaacaacggaaagggcagccatgagtcaagtcagctggatgaaccaagtctg
gaaacacacagacttgagcattccaaagagagccaggagagtgccgatcagtcggatgtg
atcgatagtcaagcaagttccaaagccagcctggaacatcagagccacaagtttcacagc
cacaaggacaagctagtcctagaccctaagagtaaggaagatgataggtatctgaaattc
cgaatttctcatgaattagagagttcatcttctgaggtcaactaa

DBGET integrated database retrieval system