KEGG   Mus musculus (house mouse): 213311
Entry
213311            CDS       T01002                                 
Symbol
Fbxl21, D630045D17Rik, FBL3B, FBXL3B, Psttm
Name
(RefSeq) F-box and leucine-rich repeat protein 21
  KO
K10287  F-box and leucine-rich repeat protein 21
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    213311 (Fbxl21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    213311 (Fbxl21)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     213311 (Fbxl21)
SSDB
Motif
Pfam: F-box-like F-box F-box_5
Other DBs
NCBI-GeneID: 213311
NCBI-ProteinID: NP_848789
MGI: 2442921
Ensembl: ENSMUSG00000035509
UniProt: Q8BFZ4
LinkDB
Position
13:56670201..56685711
AA seq 434 aa
MKRNNFSAVNKVVQSSPVVKQPKRGLCSSLRQTHALSVLLDWGTLPHHVILQIFQYLPLI
DRARASSVCRRWNEVFHIPDLWRKFEFELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVS
FKVDSSTESAEAACDILSQLVNCSIQTLGLISTAKPSFMNVPKSHFVSALTVVFVNSKSL
SSIKIEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVADHCQGLRELALNYY
ILSDEILLALSSETHVNLEHLRIDVVSENPGQIKFHSIKKRSWDALIKHSPRVNVVMYFF
LYEEEFEAFFKEETPVTHLYFGRSVSRAILGRIGLNCPRLIELVVCANGLLPLDSELIRI
AKHCKNLTSLGLSECEVSCSAFVEFVRLCGRRLTQLSIMEEVLVPDDRYTPDEVHTEVSK
HLGRVWFPDVMPIW
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaagaggaataatttctctgccgtgaataaggttgtccagtcgtcaccagtagtgaaa
cagcccaaacgtgggctctgctcttccctccgccagacccatgcgctctctgtccttctg
gactgggggactttacctcaccatgtcatattacagatctttcagtaccttcctttaata
gatcgagcccgggcttcgtccgtgtgcaggagatggaatgaagtattccacatccctgat
ctttggaggaagtttgagtttgagctgaaccaatcagcaacttcttatttcaagtccact
catcccgacctcattcaacagatcatcaaaaagcacgctgcacatcttcagtatgtcagc
tttaaggttgatagcagtactgagtcggcagaagccgcctgtgatatcctttctcagctg
gtaaattgttctatccagaccttgggattgatttcaacagccaaaccaagtttcatgaat
gtgcccaagtctcactttgtgtcggcacttacggtcgtgtttgtcaactcaaaatcgtta
tcatcgattaaaattgaggacacgccagtggatgacccttccctgaagattcttgtggct
aacaacagtgacacccttcgactcctcaaaatgagtagctgtcctcacgtttcatctgat
gggatcctctgtgtggcggaccactgtcagggcctccgagagctggccctgaattactac
attctgagcgacgaaattctccttgcgctctccagcgagactcacgtgaacctcgaacat
ctccggatagacgttgtgagtgaaaacccggggcagatcaagttccattctattaagaaa
cgcagctgggacgcactgatcaaacactccccgagagtgaacgtcgtcatgtacttcttc
ttgtatgaagaagagtttgaggcattcttcaaagaggaaacccccgtcactcacctttat
ttcggacgttcagtaagcagagccatcctgggccggataggtcttaactgcccgaggctg
atcgagttagtggtgtgtgccaatggccttctgcccctggacagtgaactcatccgtatt
gccaagcattgtaaaaatctaacctccttgggcctgagtgagtgtgaagtcagctgcagc
gcatttgtagagtttgtgagactctgtggcagaaggctcacccagctgtctatcatggag
gaagttctggtccctgacgacaggtacaccccagatgaagtccacactgaagtctctaag
cacctgggaagagtgtggtttccggatgtgatgcccatctggtaa

DBGET integrated database retrieval system