KEGG   Mus musculus (house mouse): 215280
Entry
215280            CDS       T01002                                 
Symbol
Wipf1, D2Ertd120e, WIP, Waspip
Name
(RefSeq) WAS/WASL interacting protein family, member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    215280 (Wipf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    215280 (Wipf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    215280 (Wipf1)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    215280 (Wipf1)
SSDB
Motif
Pfam: WH2 GRP
Other DBs
NCBI-GeneID: 215280
NCBI-ProteinID: NP_001276651
MGI: 2178801
Ensembl: ENSMUSG00000075284
UniProt: Q8K1I7
LinkDB
Position
2:complement(73259954..73359831)
AA seq 493 aa
MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGASAGGYGGGGGGGGGGGGGGGGSGGNFGGGGPPGLGGLFQAGMPKLRSTANRDN
DSGGSRPPILPPGGRATSAKPFSPPSGPGRFPAPSPGHRSGPPEPPRNRMPPPRPDVGSK
PDSLPPPVPNTPRPVPSSLHNRGSPAGLGAPRPPFPGNRGAAFGAGSARQNPSGSSSPFP
RPPLPPTPSRALDDKPPPPPPPVGNRPSMHREAVPPPPSQTSKPPVPSTPRPGLGSQAPP
PPPPPSRPGPPPLPPASNDEIPRLPQRNLSLTSSAPPLPSPGRSGPLPPPPSERPPPPVR
DPPGRSGPLPPPPPINRNGSTARALPATPQLPSRSGMDSPRSGPRPPLPPDRPGAGAPPP
PPPSTSVRNGFQDSSCEDEWESRFYFHPISDLPPPEPYVPTTKTYPSKLARNESRSGSNR
RERGAPPLPPIPR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcctgtccctcccccaccagcacccccaccgccaccaacatttgcactcgctaacact
gagaagcccaccttgaacaagacagagcaggctgggaggaatgctcttctctctgacatc
agcaaagggaagaagctaaagaagacggtcaccaatgacagaagtgccccaatattggac
aaaccaaagggagccggcgccagtgctggtggctatggtggaggcggcggaggtggtggt
ggaggaggaggaggaggaggaggcagcggtggaaattttggagggggtggtcctccagga
ctgggaggactattccaggctggaatgccgaagctgaggtccaccgccaacagggataat
gattctggaggaagccgaccaccgattttgccaccgggaggaagagccacatctgccaag
cccttttcacccccgagtggcccggggaggtttcccgcaccctccccaggccacaggagt
gggcccccagagccacccaggaacagaatgcctcccccgaggcctgacgtgggctcaaaa
ccagatagccttccccctccggtaccaaatacgccaagacctgttccgtcgagtctgcac
aaccggggatccccagcagggctgggagcccccaggcccccctttcccgggaaccgaggt
gctgcttttggagcaggctctgcgcgccagaacccctccggctcctcctctccgtttcct
aggccccctttgccccccaccccaagccgagccttggatgacaagccccctccaccacct
cctcccgtgggcaacaggccctccatgcacagagaagcggtgccccctcccccctcacag
accagcaaacctccagtgccttccaccccgcggcctgggttgggttcgcaggcaccacct
cctcctccaccgcccagccggccagggccccctcctctgcctccagcttccaacgacgag
atccccaggctgccacagcggaacctgtccctcacgtcctctgcacctccattgccttca
cctggacgctcagggcctctccctcccccacccagcgagaggccccctcctcctgtaagg
gatccaccaggcagatcaggccccctcccaccaccacctccaataaacagaaatggaagc
acagctcgggccctgcctgccacccctcagttgccatccaggagtggaatggacagtccc
agaagtgggcctaggcctcctcttcctcctgacaggcctggtgctggggcgccgccccca
cccccaccctccacatcagttcgaaatggcttccaagactcatcgtgtgaagatgagtgg
gaaagcagattctacttccatccgatttctgacttgccgcctccagagccatacgtaccg
acaaccaagacgtatcccagcaaactggccagaaacgaaagccgaagtggatccaacaga
agagaaaggggcgccccaccccttcctcccatcccgaggtga

KEGG   Mus musculus (house mouse): 330319
Entry
330319            CDS       T01002                                 
Symbol
Wipf3, 9030621G03
Name
(RefSeq) WAS/WASL interacting protein family, member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    330319 (Wipf3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    330319 (Wipf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    330319 (Wipf3)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    330319 (Wipf3)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 330319
NCBI-ProteinID: NP_001161332
MGI: 3044681
Ensembl: ENSMUSG00000086040
UniProt: E9Q2D0
LinkDB
Position
6:54406206..54480753
AA seq 483 aa
MPVPPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKPDLKGRSAL
LADIQQGTRLRKVTQINDRSAPQIEGSKGTSKEGGAAGSNARGGNTPPALGDLFAGGFPV
LRPAGQRDVSGGKSGQGPGSRAPSPRLPIKAISGPLPAPASPRLGNASETHSSARPVPPR
PSVPAPPPPTPPPPPPPPLPPASPIKAQLVSPPAPPTKVNPSVVPPPLPCAPPLPPPPPT
PPPLPPASALSDKAVRPQLAPLHLPPIPPPLPLLPPCGYPGLHSEPNSPAQEVREPPAPP
PPPPPPPPPPLPTYASCSSRTAVAPPPLPGANNSGSETPPPLPPKSPSFQTQKALPTPPG
APGPQAILQKKRRGPGTSGGKLNPPPAPPARSPTTELSSKSQQPGGQLRNGGQHAIDDFE
SKFTFHSMEDFPPPDEYKPCQKIYPSKVPRSRTPGSWLQAEAAGQSSDDIKSRNSQLSLK
ALR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccggtgccaccgccaccaccgccaccacctccacctccacctccaccccctccacca
ctaggggctccaccccctccaccacttggggcgccaccccctccacccccaccagggcct
ccggtcagcacagacacccccagcttaaggaagccagatctgaaaggccggagtgcactg
ttggctgatatccagcaaggaacacgcctgcggaaagtcacccagatcaatgaccgcagt
gccccacagatcgagggttcaaaaggaaccagcaaagagggaggagctgctggcagcaat
gccaggggaggaaacacaccccctgccctgggagatctctttgctggtggctttcctgtg
ttgagaccggcaggccagagagatgtgtcaggtggcaagtccgggcagggccctggctcc
cgagcaccttctccccggctccctatcaaagccatcagcggcccgcttcccgctcctgca
tctcccaggctaggcaatgcctcagagacgcacagctctgccaggcctgtccctcctcgc
cccagtgtgcctgccccaccacctcccactccacccccacccccacctccgcccctcccc
ccagcctcccccatcaaagcccagttggtgtccccgcctgcccctccaaccaaggtgaat
ccatctgtggtgccacctcctctaccctgcgcacctcctcttccgccccctcccccgact
ccgcccccgctgcccccagcctcggcgctgagcgacaaggcagtgaggccccaactagcc
ccactgcacctgccacccatcccacccccgctccctctccttccaccctgtgggtacccc
gggctccactcagagcccaacagccctgcacaggaggtgcgagaacctccagctccgcca
ccgccaccacccccacctccgccaccaccgctccccacctatgcctcttgctcctcgagg
accgctgtggccccgccccctttgccaggcgcaaacaacagcggcagcgagactcctccc
ccgttgccccccaagtcccccagcttccagacgcagaaggccttgcccacacctccaggt
gctcccggccctcaggctatcctgcagaagaagcggcgaggcccaggaaccagtggggga
aagctaaacccacctccagccccacctgcaagatcgcccaccacagagctttccagcaaa
agccagcagcctggaggccagctgcggaatggaggccagcacgcgattgatgacttcgag
tctaaattcacgttccactccatggaagactttccccctccagatgaatacaaaccatgt
cagaagatttaccccagcaaggtccccagaagccgcacacctggttcctggctccaagct
gaggcggctgggcagagctctgatgacatcaaaagcagaaactctcagttatctctgaag
gcactccggtga

KEGG   Mus musculus (house mouse): 68524
Entry
68524             CDS       T01002                                 
Symbol
Wipf2, 1110014J05Rik, 5730509C05Rik, Gm1176, Wich, Wire
Name
(RefSeq) WAS/WASL interacting protein family, member 2
  KO
K19475  WAS/WASL-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    68524 (Wipf2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    68524 (Wipf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68524 (Wipf2)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    68524 (Wipf2)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 68524
NCBI-ProteinID: NP_922922
MGI: 1924462
Ensembl: ENSMUSG00000038013
UniProt: Q6PEV3
LinkDB
Position
11:98754424..98796404
AA seq 440 aa
MPIPPPPPPPPGPPPPPTFNQANTEQPKLSRDEQRNRGALLQDICKGTKLKKVTNVNDRS
APVIEKPRGSSGGYGPGAAALQPKGGLFQGGVPKLRPVGAKDASEAPAGKPALQVPSSRA
AAPRPPGSAASGRPHDDTDSNRASLPELPRMQRPSLPDLSRPNTASGTGMKHSSSAPPPP
PPGRRANAPPTPLPLHSNKAQAYNREKPLPPTPGQRLHPGREGHPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SATPSLLSNRPPPPAREPPSRGAAPPPPPPMIRNGARDAPPPPPPYRMHGSEPPSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHLQRV
YPSKTNRAARGAPPLPPILR
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccaattcctcctccccctccgcccccgcctggtcctcccccacctcccacatttaat
caggcaaacacagaacagcccaaactcagtagagatgagcagcggaatcgaggcgccctc
ttacaagacatttgcaaagggaccaaactaaagaaggtgaccaacgttaatgatcggagt
gctcctgtcatcgagaagcccagagggagcagtggtggctacggccccggagctgctgct
ctgcagcccaaaggaggtctctttcaaggaggagtgccgaagctccgacctgtgggagcc
aaggatgcttcagaggctccagctggtaagccggccctgcaagtccccagctctcgagct
gctgctccaaggcctccggggtctgcagccagtgggcgtcctcacgatgatacagacagc
aaccgagcctccctcccagaactgccccggatgcagagaccctccttaccggacctctct
aggcccaacaccgccagtggcacaggcatgaagcacagctcctctgcacctcccccacca
cctccagggcggcgtgccaacgcgccccccacccctctgcctctgcacagcaacaaagcc
caagcctacaacagggagaaaccattgcctccaacacctggacagaggctgcaccctgga
cgagaaggacatcctgctccaccccctgtaaagccacctccttcccctgtgaacatcaga
acaggacccagtggccagtctctggctcctcccccaccgccttaccgccagcctcctggg
gtccccaatggaccctcaagccccaccaatgagtcagcccctgagctgccacagagacac
aattctttgcataggaaaacgccagggcccgtcagaggccttgcacctcctccacccacc
tcagccaccccctccttgttgagtaacaggccacctcccccagcccgagagcctcctagc
aggggagcagctcccccgcccccaccgcccatgatccgaaatggtgccagggatgctccc
cctcctcccccaccttaccggatgcatgggtcagagccaccaagcagaggaaagccccca
cctccaccctccaggacaccagctgggccgccccctcccccaccaccccccttgcggaat
ggccatagagactccatcaccactgtccgctccttcttggatgactttgaatccaagtac
tccttccatccagtggaggacttccctgctccagaagaatataaacatcttcaaagagta
taccccagcaaaacaaaccgagctgcccgtggagccccacctctcccacccattctcagg
tga

DBGET integrated database retrieval system