KEGG   Mus musculus (house mouse): 217166
Entry
217166            CDS       T01002                                 
Symbol
Nr1d1, A530070C09Rik, R75201
Name
(RefSeq) nuclear receptor subfamily 1, group D, member 1
  KO
K03728  nuclear receptor subfamily 1 group D member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    217166 (Nr1d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    217166 (Nr1d1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    217166 (Nr1d1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    217166 (Nr1d1)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   217166 (Nr1d1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 217166
NCBI-ProteinID: NP_663409
MGI: 2444210
Ensembl: ENSMUSG00000020889
UniProt: Q3UV55
LinkDB
Position
11:complement(98658758..98666233)
AA seq 615 aa
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSAPPSLSDDSSPSSASSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGT
SNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVR
INRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSLCPLET
SPTPHPTSGSMGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTMEDVISQVARAHREI
FTYAHDKLGTSPGNFNANHASGSPSATTPHRWESQGCPSAPNDNNLLAAQRHNEALNGLR
QGPSSYPPTWPSGPTHHSCHQPNSNGHRLCPTHVYSAPEGEAPANSLRQGNTKNVLLACP
MNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEV
LMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGL
FTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLN
NMHSEKLLSFRVDAQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgacgaccctggactccaataacaacacaggtggtgttatcacctacattggctctagt
ggctcctccccgagccggaccagcccggagtccctctacagtgacagctccaatggcagc
ttccagtccctgactcaaggttgtcccacatacttcccaccatcacctactggctccctc
acccaggaccctgcccgctcttttggcagtgcgccacccagtctcagtgatgatagctcc
ccttcttctgcatcatcgtcatcctcttcatcctcctcctccttctataacgggagcccc
ccaggaagtctacaagtggccatggaagacagcagccgagtgtcccccagcaagggcaca
agcaacattaccaagctgaatggcatggtgctactgtgtaaggtgtgtggggacgtggcc
tcaggcttccactatggagtgcacgcctgtgagggctgcaagggcttttttcgccggagc
atccaacagaatatccagtacaaacggtgtctgaaaaacgaaaactgctccatcgttcgc
atcaatcgcaaccgctgccagcagtgtcgcttcaagaagtgtctctccgttggcatgtct
agagatgctgtgcgttttgggcgcatccccaagagagagaagcaacggatgcttgccgag
atgcagagcgccatgaacttggccaacaaccaactgagcagcctgtgccctctagagacc
tcacctactccacatcccacctctggctccatgggcccctcacctcctcctgcaccagcc
cccacacctttggtgggcttctctcagttcccacaacagctgacaccacccaggtctccc
agccctgagcccaccatggaggatgtgatatcccaggtcgcccgggcccatcgagaaatc
ttcacctatgcccatgacaagttaggcacctcacctggtaacttcaatgccaatcatgca
tcaggtagcccttcagctacaactccacaccgctgggagagtcagggatgcccgtctgcc
cccaacgacaacaaccttttggcggctcagcgtcataatgaagcgctgaatggtctacgc
cagggcccttcctcctacccgcctacctggccttctggccccacccaccacagctgccac
caacctaacagcaatgggcaccgtctgtgccccacccacgtatattcggccccagaaggg
gaggcacctgccaacagtctacggcaaggcaacaccaagaatgttctgctggcatgtccc
atgaacatgtatccccatggacgcagcggccggactgtgcaggagatctgggaagacttc
tctatgagcttcacgcctgccgttcgggaggtggtagagtttgccaaacacatcccaggc
ttccgtgacctttctcagcacgaccaggtgaccctgcttaaggctggcacctttgaggtg
ctgatggtgcgctttgcatcgttgttcaacgtgaaggaccagacagtgatgttcctgagc
cgcacaacctacagtctgcaggagctcggtgccatgggcatgggcgacctgctcaatgcc
atgtttgacttcagcgagaagctcaactccctggcacttaccgaggaggagctgggccta
ttcaccgcggtggtgcttgtctctgcagaccgctcgggaatggagaattccgcttcggtg
gagcagctccaggagacgctgctgcgggctcttcgggctctggtgctgaagaaccggccc
tcggagacttcccgcttcaccaagctgctgctcaagctgccggacctgcggaccctgaac
aacatgcattccgagaagctgctgtccttccgggtggacgcccagtga

KEGG   Mus musculus (house mouse): 353187
Entry
353187            CDS       T01002                                 
Symbol
Nr1d2, RVR, Rev-erb
Name
(RefSeq) nuclear receptor subfamily 1, group D, member 2
  KO
K08531  nuclear receptor subfamily 1 group D member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    353187 (Nr1d2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    353187 (Nr1d2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    353187 (Nr1d2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    353187 (Nr1d2)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   353187 (Nr1d2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep LpxD
Other DBs
NCBI-GeneID: 353187
NCBI-ProteinID: NP_035714
MGI: 2449205
Ensembl: ENSMUSG00000021775
UniProt: Q60674 Q4VAB7 Q8C6J1 Q8C598
LinkDB
Position
14:4230549..4265640
AA seq 576 aa
MELNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNCDANGNPKNADI
SSIDGVLKSDRTDCPVKTGKTSAPGMTKSHSGMTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNTQFSGHLQNDTLAEQHDQSALPAQEQLRPKSQLEQENIKN
TPSDFAKEEVIGMVTRAHKDTFLYNQEHRENSSESMPPQRGERIPRNMEQYNLNQDHRGS
GIHNHFPCSERQQHLSGQYKGRNIMHYPNGHAVCIANGHCMNFSSAYTQRVCDRIPVGGC
SQTENRNSYLCNTGGRMHLVCPMSKSPYVDPQKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
SSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggagctgaacgcaggaggtgtgattgcctacatcagttcctctagctctgcctccagc
cctgcctcttgtcacagtgagggttctgagaatagcttccagtcctcgtcctcgtctgtt
ccatcttctccaaatagctctaactgtgatgccaacggcaatcccaagaacgctgatatc
tctagcatcgatggtgttctgaagagtgaccgcacagattgtcctgtgaaaacaggcaaa
accagtgctcctggcatgactaagagtcacagtggaatgacaaaatttagtggcatggtt
ctactgtgtaaagtctgtggggatgtggcatcaggattccactatggagttcatgcttgt
gaaggctgtaagggtttctttcggaggagcattcagcaaaacatccagtataagaagtgc
ctgaagaatgagaactgttccatcatgaggatgaacaggaaccggtgccagcagtgccgc
tttaagaagtgtctgtctgtggggatgtcacgagatgctgttcgatttggccgaattcct
aagcgtgaaaaacagagaatgctaattgaaatgcaaagtgcaatgaagaccatgatgaac
acccagttcagtggccacctgcagaatgacaccttagcagaacagcatgatcagtcagca
ctaccagctcaggaacagctgcggcccaagtcccagctggagcaagaaaacatcaaaaac
actccttctgattttgcaaaggaggaagtgattggtatggtgaccagagcccacaaggat
acctttctgtataatcaggaacatcgagaaaactcatctgagagcatgccacctcagaga
ggagaacggattcccaggaacatggagcaatataatttaaatcaagaccatcgtggcagt
gggattcacaaccacttcccctgtagtgagaggcagcaacatctcagtggacagtacaaa
gggaggaacataatgcattacccaaacggccatgccgtttgtattgcaaatggacactgt
atgaacttctccagtgcttatactcaaagagtctgtgatagaattccagtaggtggatgt
tctcagactgagaacagaaatagttacctgtgcaacactggagggaggatgcatctggtg
tgtcctatgagcaagtctccatatgtggaccctcagaagtctggacatgaaatctgggaa
gaattttcaatgagttttaccccagcagtaaaagaggtggtggaatttgcaaagaggatt
cctggcttccgagatctgtctcagcatgatcaggtcaatctgttaaaagctgggactttt
gaggttttaatggtacgatttgcttcattatttgatgcaaaggaacggactgtcaccttt
ctaagtggtaagaagtacagtgtggatgacctgcactcaatgggagcaggggatctgctc
agctctatgtttgagttcagtgagaagctgaatgccctccagctcagtgatgaggaaatg
agcttgttcacagcagttgttctggtatctgcagatcgatctggaattgaaaatgtcaac
tcagtggaggctttgcaggaaacactcatccgtgcactaaggaccttaataatgaaaaac
catccaaatgaggcctccatttttacaaaattacttctaaagttgccagatcttcgatct
ttaaacaacatgcactctgaggaactcttggcctttaaagttcatccttaa

DBGET integrated database retrieval system