KEGG   Mus musculus (house mouse): 21824
Entry
21824             CDS       T01002                                 
Symbol
Thbd, AI385582, CD141, TM
Name
(RefSeq) thrombomodulin
  KO
K03907  thrombomodulin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    21824 (Thbd)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    21824 (Thbd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    21824 (Thbd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    21824 (Thbd)
   00535 Proteoglycans [BR:mmu00535]
    21824 (Thbd)
   04091 Lectins [BR:mmu04091]
    21824 (Thbd)
CD molecules [BR:mmu04090]
 Proteins
  21824 (Thbd)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   21824 (Thbd)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 14: Thrombomodulin
   21824 (Thbd)
SSDB
Motif
Pfam: FXa_inhibition Tme5_EGF_like cEGF EGF_CA Lectin_C
Other DBs
NCBI-GeneID: 21824
NCBI-ProteinID: NP_033404
MGI: 98736
Ensembl: ENSMUSG00000074743
Vega: OTTMUSG00000015710
UniProt: P15306 Q543W3
LinkDB
Position
2:complement(148246391..148250108)
AA seq 577 aa
MLGIFFLGVLAPASLGLSALAKLQPTGSQCVEHECFALFQGPATFLDASQACQRLQGHLM
TVRSSVAADVISLLLSQSSMDLGPWIGLQLPQGCDDPVHLGPLRGFQWVTGDNHTSYSRW
ARPNDQTAPLCGPLCVTVSTATEAAPGEPAWEEKPCETETQGFLCEFYFTASCRPLTVNT
RDPEAAHISSTYNTPFGVSGADFQTLPVGSSAAVEPLGLELVCRAPPGTSEGHWAWEATG
AWNCSVENGGCEYLCNRSTNEPRCLCPRDMDLQADGRSCARPVVQSCNELCEHFCVSNAE
VPGSYSCMCETGYQLAADGHRCEDVDDCKQGPNPCPQLCVNTKGGFECFCYDGYELVDGE
CVELLDPCFGSNCEFQCQPVSPTDYRCICAPGFAPKPDEPHKCEMFCNETSCPADCDPNS
PTVCECPEGFILDEGSVCTDIDECSQGECFTSECRNFPGSYECICGPDTALAGQISKDCD
PIPVREDTKEEEGSGEPPVSPTPGSPTGPPSARPVHSGVLIGISIASLSLVVALLALLCH
LRKKQGAARAELEYKCASSAKEVVLQHVRTDRTLQKF
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcttgggattttctttctgggtgtgctggctccagctagcctggggctctccgcacta
gccaagctgcagcccacaggcagtcaatgcgtggagcatgagtgcttcgcgcttttccag
ggccccgcgaccttcctcgatgccagccaggcctgccagcgcctgcaaggacatttgatg
acagtgcgctcctcagtggctgccgatgtcatctcccttctgctgagccagagcagtatg
gatttagggccctggatcggtttacagctcccgcagggctgtgacgacccggtgcatctc
gggcccctgcgcggcttccagtgggttactggcgataaccacaccagttacagcaggtgg
gcgcggcccaacgaccagacggctccactctgcggccctctgtgcgtcacggtctcgaca
gcaactgaagctgcacccggcgagccggcctgggaagagaagccatgcgagactgagacc
cagggtttcctctgtgagttttacttcacagcttcctgcaggcctctgacggtgaatact
cgcgatcctgaggctgcccacatctctagtacctacaacaccccgttcggggtcagtggt
gcggactttcaaacgctgccggtaggcagttccgccgcggtggagccccttggcttggag
ctggtgtgcagggccccgcccggaacttcagagggacactgggcttgggaagcgacagga
gcctggaattgcagcgtggagaatggtggctgtgagtacttgtgcaataggagcacgaat
gaacccagatgcctctgccccagagacatggacctgcaggccgatggacgttcgtgtgca
agacctgtggttcaatcgtgcaacgaactctgcgagcatttttgtgtcagcaacgctgaa
gtgccaggctcttactcctgtatgtgtgagacaggctaccagttggctgcagacggacac
cggtgtgaggacgtggatgactgtaagcaggggcccaatccatgtccccagctctgtgtt
aacaccaagggcggcttcgaatgcttctgctatgatggctatgagttggtggatggagag
tgcgtggagcttctggatccgtgtttcggatctaactgcgagtttcagtgccagccagtg
agccccaccgactaccgatgcatctgcgctccaggcttcgcacccaagccggatgaaccg
cacaagtgcgaaatgttctgcaatgaaacttcgtgcccagcagactgtgaccctaactct
cctactgtttgtgaatgccctgaaggcttcatcctggacgagggttccgtatgcacggac
attgatgagtgcagtcaaggcgaatgcttcaccagtgaatgtcgaaacttccctggctcc
tatgagtgtatctgcgggcctgacacagcccttgctggtcagattagcaaagactgtgac
cccatccctgttagggaagacaccaaggaagaggagggctctggggagcctccagtcagc
cctacgccaggctctccgacaggtcccccttctgcaaggccagtgcactctggcgtgctc
attggcatctccattgccagcctgtccctggtggtggcgcttttggcgcttctctgtcac
ctgcgcaagaagcagggcgctgctcgtgcagagctggagtacaagtgcgcatcttccgcc
aaggaggtagtgctgcagcacgtcaggactgatcggacgctgcagaagttctga

DBGET integrated database retrieval system