KEGG   Mus musculus (house mouse): 218294
Entry
218294            CDS       T01002                                 
Symbol
Cdc14b, 2810432N10Rik, A530086E13Rik, AA472821, CDC14B3, Cdc14B1
Name
(RefSeq) CDC14 cell division cycle 14B
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    218294 (Cdc14b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    218294 (Cdc14b)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    218294 (Cdc14b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     218294 (Cdc14b)
    3.1.3.48  protein-tyrosine-phosphatase
     218294 (Cdc14b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    218294 (Cdc14b)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   218294 (Cdc14b)
SSDB
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase CDKN3 Y_phosphatase3
Other DBs
NCBI-GeneID: 218294
NCBI-ProteinID: NP_766175
MGI: 2441808
Ensembl: ENSMUSG00000033102
UniProt: Q6PFY9
LinkDB
Position
13:complement(64337085..64423670)
AA seq 485 aa
MKRKSERRSAWATAPPCSRRSSSSSPGVKKSRSSTPQELHRLEQQDDLYLDITDRLCFAI
LYSRPKSATNEHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIH
FTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLL
DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY
HQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFL
DICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFL
VMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDD
EVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIWWIVCDYILPTLLFCLD
GFRTQ
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaagcgtaagagcgagcggcgctcggcttgggccaccgcgcccccctgctcacgccgc
agctcgtcctcctctcccggcgtgaagaagagccgcagctccacgccgcaggagctgcac
cgcctggagcagcaggacgacctgtacctggacatcacggatcgcctttgttttgccatt
ctctacagcagaccaaagagtgcaacaaacgaacattatttcagcatagataacgagcta
gagtatgagaacttctatgcggattttggaccactcaatctggccatggtttacagatat
tgttgcaagataaataagaagctcaagtccattacaatgctgaggaagaaaattatccat
tttactggcactgatcagagaaagcaagcgaatgccgccttccttgtcgggtgttatatg
gttatatatttggggaggacaccagaagacgcgtatagaacattaatcttcggagataca
gcctatattcctttcagagatgctgcctatggaagctgcagtttctatattacacttctc
gactgttttcacgcagtaaagaaggcaatgcagtatggcttctttaatttcaactcattt
aaccttgacgaatatgaacactatgaaaaagcagaaaatggagatttcaactggataata
ccagagcgatttcttgccttctgtgggccccattcaagatccaggctggaaagtggttac
caccaacattctccggagacttatattccatattttaagaatcacaatgtaactaccatt
attcgtctgaataaaaggatgtatgatgctaagcgctttacggatgctggattcgatcac
catgatcttttctttccggatggcagcacccctgctgagtcaattgtccaagaatttctg
gatatttgtgaaaatgtcaagggtgccattgctgtgcattgcaaagctggccttggtcga
acaggcactctgataggctgctacctcatgaagcattacaggatgacagcagctgagagc
attgcctggctcagaatctgtagacccggctcagtaattgggccccagcaacagtttctg
gtcatgaaacaatcaagcctctggctagaaggcgactatttccgtcaaaagttaagaggg
caggagaatggccccctcagagaagccttctccaaacacctttcggatgctgatgacctg
tccttaaatgggcttgagaatcaagacaatcaagagcctgagccgtatagtgatgatgat
gaagtcagtggaatgacacaaggagacagacttcgggccctgaaaagccggagacagccg
aaagccagcgctatccccctcacatgtcccctagctgtgctgacctctgcactgtgtagt
gttgccatctggtggattgtgtgtgactacattcttcccaccctgctgttctgtcttgat
ggcttcagaacacagtag

KEGG   Mus musculus (house mouse): 229776
Entry
229776            CDS       T01002                                 
Symbol
Cdc14a, A830059A17Rik, CDC14A2, CDC14a1, Cdc14
Name
(RefSeq) CDC14 cell division cycle 14A
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    229776 (Cdc14a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    229776 (Cdc14a)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    229776 (Cdc14a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     229776 (Cdc14a)
    3.1.3.48  protein-tyrosine-phosphatase
     229776 (Cdc14a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    229776 (Cdc14a)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   229776 (Cdc14a)
SSDB
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3
Other DBs
NCBI-GeneID: 229776
NCBI-ProteinID: NP_001074287
MGI: 2442676
Ensembl: ENSMUSG00000033502
UniProt: Q6GQT0
LinkDB
Position
3:complement(116066202..116222390)
AA seq 603 aa
MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIISTLD
DMSIGANLSKLQSTERIGENNFEDEDMEIKNNVTQGDKLRALKSQRHPRSSPSCAFRSDD
MKGHQRAMAQTFRLSSSPQPTMSTMKTSKVCLSPSVTAKKISRGSLSSGANIRSFSINSR
LASSLGNLNAGTEEPETKKTTSLTKAAFIASPFTSFLNGSTQTPGRNYPELNNNQYTRSS
NSNSSSSSSGLGGNLNSSPVPQSAKPEEHTTILRPSFPGSLSSSSVRFLSRSIPSLQSEY
VHY
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggcagcggagtctggggaactaatcggggcttgcgagttcatgaaagatcgattatat
tttgctactttaaggaatagaccaaaaagcacaataaatatccactatttctccatcgac
gaggagctggtctatgaaaatttctatgcagattttggacctctgaacttggcaatggtg
tacagatactgctgtaagctaaacaagaaactaaaatcatacagtttatcaagaaagaag
atagtgcactacacctctttcgaccagcggaaaagagcaaacgcagcattcttgataggt
gcttatgccgtcatctacttaaagaagacaccagaagaagcgtacagagctctcctgtct
ggctcaaaccctccttatcttccattcagggatgcatcttttggaaactgcacttacaac
ctcaccgtccttgactgtttacaaggaatcagaaagggattacagcatgggttttttgac
tttgagacgtttgatgcggaagaatatgaacattatgagcgagttgaaaacggagacttc
aactggatcgttccaggaaagtttttagcgttcagtggaccgcatcctaaaagcaagatt
gagaatggttaccctctccacgctcccgaagcctactttccatacttcaaaaagaacaac
gtgaccacgatcgtgagattgaacaaaaagatctacgaggcgaagcgcttcacagacgct
ggcttcgagcactatgacctgttcttcatagacggcagcacccccagcgataacatcgtg
cggagattcctgaacatctgtgagaacaccgagggggccatcgcggtccactgcaaagct
ggtctgggaagaaccgggacattgatagcctgttatgtcatgaaacactacaggtttaca
catgctgaaatcattgcttggatcagaatttgccgaccaggctccatcatcggaccccag
cagcacttcctgaaagaaaaacaagcatcattgtgggtccaaggagacatttttagatcc
aaactaaaaaatagaccatccagtgagggaagtattacaaaaattatttctaccctggat
gatatgtctattggtgcaaatttatccaaattacaaagcacagaaaggattggagagaat
aattttgaagacgaagatatggaaattaagaacaacgtaacgcagggagacaaactacgt
gccttaaaaagccagaggcatccccgctcctcgccatcctgtgcatttaggtcagatgat
atgaaaggacaccaaagggcaatggcccagactttcagattaagttcctcaccgcaacca
actatgtcgaccatgaagacctccaaagtgtgtttgtccccttcagtgacagccaaaaaa
ataagccgaggttctttgtcttcaggagcaaatataagaagcttctccataaattcccgg
ctagccagttctctagggaacttgaacgccgggacagaagaacctgagaccaagaagacc
acatcactcaccaaggccgctttcatagccagcccattcaccagcttcttgaatggcagc
acccagacacctggcagaaactaccctgagctcaacaacaaccagtacaccagaagcagc
aacagcaacagcagcagcagcagcagcggtcttgggggcaacctgaacagctctccagtc
ccccagagcgccaagcccgaggagcacaccaccatccttcgaccttccttcccggggtca
ctctcttcctcctcagtgagattcctgagccgttctataccttcccttcagtctgaatac
gttcattactaa

DBGET integrated database retrieval system