KEGG   Mus musculus (house mouse): 22029
Entry
22029             CDS       T01002                                 
Symbol
Traf1, 4732496E14Rik
Name
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04668  TNF signaling pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    22029 (Traf1)
   04668 TNF signaling pathway
    22029 (Traf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    22029 (Traf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22029 (Traf1)
   05202 Transcriptional misregulation in cancer
    22029 (Traf1)
   05203 Viral carcinogenesis
    22029 (Traf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22029 (Traf1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF PilJ
Other DBs
NCBI-GeneID: 22029
NCBI-ProteinID: NP_001313530
MGI: 101836
Ensembl: ENSMUSG00000026875
UniProt: P39428
LinkDB
Position
2:complement(34831762..34851784)
AA seq 409 aa
MASSSAPDENEFQFGCPPAPCQDPSEPRVLCCTACLSENLRDDEDRICPKCRADNLHPVS
PGSPLTQEKVHSDVAEAEIMCPFAGVGCSFKGSPQSMQEHEATSQSSHLYLLLAVLKEWK
SSPGSNLGSAPMALERNLSELQLQAAVEATGDLEVDCYRAPCCESQEELALQHLVKEKLL
AQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQKD
QVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCL
RLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLS
SASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcctccagctcagcccctgatgaaaacgagtttcaatttggttgcccccctgctccc
tgccaggacccatcggagcccagagttctctgctgcacagcctgtctctctgagaacctg
agagatgatgaggatcggatctgtcctaaatgcagagcagacaacctccatcctgtgagc
ccaggaagccctctgactcaggagaaggttcactctgatgtagctgaggctgaaatcatg
tgcccctttgcaggtgttggctgttccttcaaggggagcccacaatccatgcaggagcat
gaggctacctcccagtcctcccacctgtacctgctgctggcggtcttaaaggagtggaaa
tcctcaccaggctccaacctagggtctgcacccatggcactggagcggaacctgtcagag
ctgcagcttcaggcagctgtggaagcgacaggggacctggaggtagactgctaccgggca
ccttgctgtgagagccaggaagaactggccctgcagcacttggtgaaggagaagctgctg
gctcagctggaggagaagctgcgtgtgtttgcaaacattgttgctgtcctcaacaaggaa
gtggaggcttcccacctggcactggccgcctccatccaccagagccagttggaccgagag
cacatcctgagcttggagcagagggtggtggaattacagcaaaccctggctcaaaaagac
caggtcctgggcaagcttgagcacagtctgcgactcatggaggaggcatcctttgatggt
actttcctgtggaagatcaccaatgtcaccaagcggtgccacgagtcagtgtgtggccgg
actgtcagcctcttctctccagctttctacactgccaagtatggttacaagttgtgcctg
cgcttgtacctgaacggggatggctcaggcaagaagacccacctgtccctcttcatcgtg
atcatgagaggagaatacgatgctctcctgccctggcctttcaggaacaaggtcaccttt
atgctacttgaccagaacaaccgagagcatgctattgatgccttccggcctgacctgagc
tcagcctccttccagcggccacagagtgagaccaacgtggccagcggctgcccgctcttc
ttccccctcagcaagctgcagtcacccaagcacgcctacgtcaaagatgacacaatgttc
ctcaaatgcattgtggacactagtgcttag

DBGET integrated database retrieval system