KEGG   Mus musculus (house mouse): 22642
Entry
22642             CDS       T01002                                 
Symbol
Zbtb17, AA589413, Lp-1, Miz1, Zfp100, mZ13
Name
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22642 (Zbtb17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22642 (Zbtb17)
   05202 Transcriptional misregulation in cancer
    22642 (Zbtb17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22642 (Zbtb17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22642 (Zbtb17)
   04121 Ubiquitin system [BR:mmu04121]
    22642 (Zbtb17)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    22642 (Zbtb17)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     22642 (Zbtb17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf-C2HC_2 zf-BED zinc_ribbon_15 zf-C2HE zf_UBZ Packaging_FI HypA
Other DBs
NCBI-GeneID: 22642
NCBI-ProteinID: NP_033567
MGI: 107410
Ensembl: ENSMUSG00000006215
UniProt: Q60821 A6H6B9
LinkDB
Position
4:141171984..141195248
AA seq 794 aa
MDFPQHSQRVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIVTACHTLKSLAEPSST
TGESADASAVEGGDKRAKDEKAAATMLSRLDQARGSSSTGPGRELKEERGGQAESASSGA
EQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEMEVEPASKGEDGQEEEGAGP
ATVKEEGMHLDNGEPPEENEESAGTDSGQELGMEGQNLRSGTYGDRTESKAYGSIIHKCE
DCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGK
SYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGQKPYQCDYCGRSFSD
PTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNL
KRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHV
RQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHT
GEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEA
LAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDA
NSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQMLQAGELVFRPRDGTEGQPTLA
ESPPTAPDCLPPAE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggatttcccccagcacagccagcgtgtcttggagcagctgaaccagcagcggcaactg
ggcctcctctgtgactgcacctttgtggtggacggcgttgacttcaaggctcacaaggcg
gtgctggcagcttgcagcgagtacttcaagatgctctttgtggaccagaaggacgtggtg
cacctagacatcagtaatgcggcaggcctggggcaggtgctggagttcatgtacactgct
aagctgagccttagccctgagaacgtggacgatgttctggccgtggccagcttcctccag
atgcaggatattgtcacggcctgccacacgctcaagtccctcgctgagccgagcagcacc
actggggagagcgcagacgcctcagctgtggaaggaggagacaagagagccaaagacgag
aaggccgctgccaccatgttgagcaggctggaccaagcaagaggcagctcctccacaggc
ccgggcagagaactcaaggaggagcggggtggccaggcagaaagtgcatccagtggcgca
gagcagacggagaaggcagacgctccccgggagcctccacctgtggagctcaagccggac
cccacaagcagcatggcggctgcagaagccgaagccttatcagagagctcagagcaagaa
atggaagtggagccagccagcaaaggagaagacggacaagaggaagagggtgcagggcct
gccacagtcaaggaagaggggatgcatctggataacggggagcctcctgaggagaatgaa
gagtctgccggcacagattctgggcaggagcttggcatggagggtcagaacctgcgctcg
ggcacctacggggatcgcactgagtccaaggcttacggctccatcatccacaagtgcgag
gactgcgggaaggagttcacgcacacagggaacttcaaacggcacatccgcatccacacg
ggggagaaacctttctcatgcagggagtgcagcaaggctttctcggaccctgcagcgtgc
aaggctcatgagaagacacacagcccgttgaaaccctatgggtgtgaggagtgtggcaag
agctacaggctcatcagcctgctgaacctgcataagaagaggcactccggggaggcgcgc
taccgctgcggggactgtggcaagctcttcaccacttcaggcaacctcaagcgccaccag
ctggtacacagtggccagaaaccctaccagtgcgactactgtggccgctccttctctgac
cccacctctaagatgcgccacctggagactcacgacaccgacaaggaacacaagtgtcct
cactgcgacaaaaagttcaaccaggtggggaacctgaaggcccacttgaagatccacatt
gccgatggccctcttaagtgccgggagtgcgggaagcagttcaccacctcagggaacctc
aagcggcacctgcggatccacagtggggagaagccgtacgtatgcacccactgtcagcgg
cagtttgccgacccaggcgcgctacagcggcacgtccggatccacacgggtgagaagccg
tgccagtgtgtgatatgtggtaaggcctttacccaagccagctccctcatcgcccatgta
cgccaacacacgggggagaagccctacgtctgtgaacgctgtggcaagagatttgtccag
tccagccagttggccaaccacatccgtcaccatgacaacatccgaccgcacaagtgcagc
gtgtgtagcaaggccttcgtgaatgtgggggacctgtccaagcacattatcatccacacc
ggagagaagccttatttgtgtgacaaatgtggccgtggtttcaaccgggtagacaacctg
cgttctcatgtaaagaccgtgcatcagggcaaggcgggcatcaagatcctggagccagaa
gagggtggtgaggtcagcgtggtcactgtggacgacatggtcaccctggccactgaggct
ctggcagcgacagcggtcactcagctaacagtggtaccagtgggggccgcagtgacagct
gacgagacggaagtactcaaagctgagatcagcaaagctgtcaagcaagtgcaggaagaa
gaccccaacacccacatcctctacgcttgtgattcctgtggggacaagttcctggatgcc
aatagcctagcccagcatgttcggatccacacagcccaggcactggtcatgttccagacg
gatgcggacttctaccagcagtatgggccaggcagcacgtggccagccgggcagatgctg
caggctggagagctcgtcttccgtcctagggatgggactgagggccaacccacactggca
gaaagtccacccacagctcctgattgcctaccacctgccgagtga

DBGET integrated database retrieval system