KEGG   Mus musculus (house mouse): 272381
Entry
272381            CDS       T01002                                 
Symbol
Lrrc4b, A830007M12, Lrig4, Ngl3
Name
(RefSeq) leucine rich repeat containing 4B
  KO
K16360  netrin-G3 ligand
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    272381 (Lrrc4b)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 ig LRR_9 V-set LRRNT Ig_2 LRR_1
Other DBs
NCBI-GeneID: 272381
NCBI-ProteinID: NP_937893
MGI: 3027390
Ensembl: ENSMUSG00000047085
UniProt: P0C192
Structure
LinkDB
Position
7:44091911..44112775
AA seq 709 aa
MAQAHIRGSPCPLLPPGRMSWPHGALLLLWLFSPPLRAGGGGVAVTSAAGGGSPPATSCP
AACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLS
KNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAF
NRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSG
NRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFT
PLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSH
FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHD
GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGPGGGGPGGGGGAGGA
GGYTYFTTVTVETLETQPGEEAQQPRGTEKEPPGPTTDGAWGGGRPDAAAPASASTTAPA
PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRKQ
HQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGAGVGGDSHLALPALERDHLNH
HHYVAAAFKAHYGGNPGGGCGAKGPGLNSIHEPLLFKSGSKENVQETQI
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcgcaggcccacatccgcggctccccgtgccccttgctgccgcctggtaggatgtcc
tggccccacggggctctcttgctcctgtggctcttctccccacccctgagggctggtggg
ggcggtgtggccgtgacctcagccgctggaggaggctccccgccagccacctcctgccca
gccgcctgctcctgcagcaaccaggccagccgggtgatctgcacgcggagggagctggcc
gaggtgccagccagcatccctgtcaacacccgctacctgaacctgcaagagaacagcatc
caggtgatccgcacggacacattcaagcacctccggcacctggagatcctgcagctgagc
aagaacctggtgcgaaagatcgaggtgggagcgttcaatgggctgcccagtctcaacaca
ctggaactcttcgacaaccggctgacaaccgtgcccacgcaggcctttgagtacctgtcc
aagctccgggagctgtggctgcgcaacaaccccatcgaaagcatcccatcctatgccttc
aaccgtgtgccctcactgcgccgcctagacctgggcgagctgaagaggctggagtacata
tctgaggcggccttcgaggggctggtgaacctgcgctacctcaacctgggcatgtgcaac
ctaaaggacatccccaacctcacagcacttgtgcgcctggaggagctggagctgtccggg
aaccggctggacctaattcgccctggctccttccagggcctcaccagcctgcgcaagctg
tggctgatgcatgcccaagtggccaccatcgagcgaaacgccttcgacgacctcaagtcg
ctggaggagctgaacctgtcccacaacaacctgatgtcgctgccgcacgaccttttcacg
ccccttcaccgcctggagcgtgtccacctgaaccacaacccctggcattgtaactgtgat
gtgctgtggctcagctggtggctgaaggagacagtgcccagcaataccacatgctgcgca
cgctgccacgcgcccgccggcctcaagggccgctacattggcgagctagaccagtcgcac
ttcacctgctatgccccggtcatcgtggagccacccacagacctcaatgtcaccgagggc
atggcggctgagctcaagtgccgcacaggcacatccatgacgtcggtcaactggctgaca
cctaacggcacgctcatgacgcacggttcctatcgtgtgcgcatttcagtgctgcacgat
ggcacactcaacttcaccaatgtcaccgtgcaggacacgggccagtacacgtgcatggtg
acaaactcggctggcaacactactgcctcggccacgcttaacgtgtcggccgtggacccc
gtggctgcgggagggcccggtggcgggggcccagggggtgggggcggtgcagggggcgcg
ggcggatacacctacttcaccacggtgaccgtggagacgctggagacgcagccgggggag
gaggcccagcagccccgaggtactgagaaggagcccccggggcccacgactgatggcgcg
tggggcggcggccggcctgatgctgcagccccggcctcggcgtccaccacggcaccggcc
ccgcgctcctcgcggcccacggagaaggctttcacggtgcccatcacggacgtgacggag
aatgcgcttaaggacctagacgatgtcatgaagaccaccaaaatcatcatcggctgcttc
gtggccatcaccttcatggccgccgtgatgctggtggccttctacaagctgcgcaagcag
caccagctgcacaagcaccacgggcccacgcgcactgtggagatcatcaacgtggaggac
gagctgcccgccgcctccgctgtgtcggtggctgcggccgccgcggtggctggaggcgcg
ggcgtgggtggggacagccacctggcccttccggcgctggagcgagaccacctcaatcac
caccactacgttgcggccgccttcaaggcgcactacggcggcaacccgggaggcgggtgc
ggggccaaaggccccggcctcaactccatccacgaacctctgctcttcaagagcggctcc
aaggagaacgtgcaagagacacaaatctaa

DBGET integrated database retrieval system