KEGG   Mus musculus (house mouse): 320840
Entry
320840            CDS       T01002                                 
Symbol
Negr1, 5330422G01Rik, KILON, Ntra
Name
(RefSeq) neuronal growth regulator 1
  KO
K06775  neuronal growth regulator 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    320840 (Negr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    320840 (Negr1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  IgLON family
   320840 (Negr1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Ig_5 Izumo-Ig C2-set_2 Ig_4 V-set_CD47 Ig_C17orf99
Other DBs
NCBI-GeneID: 320840
NCBI-ProteinID: NP_001034183
MGI: 2444846
Ensembl: ENSMUSG00000040037
UniProt: Q80Z24
LinkDB
Position
3:156266082..157022101
AA seq 348 aa
MVLLAQGACCSNQWLAAVLLSLCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGA
SKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTP
RTMQVHLTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEPVISWRHISPSAKPFENGQ
YLDIYGITRDQAGEYECSAENDVSFPDVKKVRVIVNFAPTIQEIKSGTVTPGRSGLIRCE
GAGVPPPAFEWYKGEKRLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTT
NASLPLNPPSTAQYGITGSACDLFSCWSLALTLSSVISIFYLKNAILQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtgctcctggcgcagggcgcttgttgctcgaaccagtggctggcggcggtgcttctg
agcctgtgctcttgcctcccggccgggcagagcgtggacttcccttgggcggccgtggac
aacatgctggtgaggaaaggtgacacagcggtgctcaggtgttacttggaagatggagca
tcaaagggtgcctggctcaacaggtcaagtatcatttttgctggaggtgacaagtggtca
gtggaccctcgagtttccatttccacattgaataaaagagactacagcctccagatacag
aatgttgatgtaacagatgatggcccgtacacctgttctgtgcagacccaacacacacca
cggacaatgcaggttcatctcactgtgcaagtcccaccgaaaatatacgacatctcaaat
gacatgaccatcaatgaaggaaccaatgtcacccttacttgtttggccactgggaagcca
gagcctgtcatttcctggaggcatatctccccatcagcaaaaccatttgaaaatggacaa
tatttggacatttatggaattacaagggaccaggctggggagtatgaatgcagtgcagaa
aacgatgtgtcgttcccagacgtgaagaaagtgagagtgatcgtgaactttgcgcctaca
attcaggaaattaaatctggcactgtgacccctggacgcagtggactgatacgatgcgag
ggtgcaggtgtgccgccgccggccttcgagtggtacaaaggagagaagaggctcttcaat
ggccaacaaggaattatcattcagaattttagcacaagatccatcctcacagtgaccaat
gtgacgcaggagcacttcggcaactatacttgtgtggctgccaacaagttgggtacaacc
aacgcgagcctgcccctcaaccctccaagtacagcccagtatggaattactgggagtgcc
tgcgacctcttctcctgctggagccttgcgttgacactatcttctgtcatcagtatattc
tacctgaagaatgctatccttcaatga

DBGET integrated database retrieval system