KEGG   Mus musculus (house mouse): 327826
Entry
327826            CDS       T01002                                 
Symbol
Frs2, 4732458E18, C330018A15Rik, Frs2alpha, SNT1
Name
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    327826 (Frs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    327826 (Frs2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    327826 (Frs2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    327826 (Frs2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   327826 (Frs2)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 327826
NCBI-ProteinID: NP_808466
MGI: 1100860
Ensembl: ENSMUSG00000020170
UniProt: Q8C180
LinkDB
Position
10:complement(116905330..116984442)
AA seq 508 aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGVMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
SSHQTELEVPRTPRTPTTPGLGAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRASVHVPPEARVSNAESNTPKEEPSNPEDRDP
QVLLKPEGVRFVLGPTPVQKQLMEKEKLEQLGKDPVSGSGAGNTEWDTGYDSDERRDVPP
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRPALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIDYSKRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgatgatgggaatgagctaggctctggtgtgatggaactc
acagacacagagctgattctgtacacccggaaacgggactcggtaaaatggcactacctc
tgcctacgacgatacggctatgactcaaatctgttttcttttgaaagtggtcgaaggtgt
cagactggacaaggaatttttgcttttaagtgtgcccgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagccggttgtagaaagg
agtagtcatcagacagagctggaagtccctaggacacctcggacacctacaactccaggg
ctcggtgctcagaacttacctaatgggtatccccgctacccctcgtttggagacgcttca
tcccacccctcaagccggcatccttcggtgggaagtgctcgcttaccttcagtcggtgaa
gagtccacacaccctttgctcgtggctgaggaacaagtacatacttatgttaacactaca
ggtgtgcaagaggagcgaaaaaaccgtgcaagtgtgcatgttcccccagaggcaagggtt
tctaatgctgagagcaacacaccaaaagaagagccgagtaaccccgaggacagggacccg
caagtgcttcttaagcctgaaggagtcaggtttgtgctaggaccaacccctgtccagaag
cagttaatggaaaaggagaaactggagcaactgggaaaagacccagtcagtgggagtgga
gcgggcaacacggagtgggacaccggctatgacagtgacgagcgcagagatgtgccccct
gtcaacaaactggtgtatgaaaatataaacgggctatctattcccagtgcctcaggggtc
aggagaggtcgtctgacatctaccagcacctcagacacccagaatatcaacaactcagcg
cagagaagacctgcactattaaactatgaaaatttaccatctttgcctcctgtttgggaa
gcccgcaagctcagtagggatgaagatgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgttaatacagagaatgtaacagtg
ccggcaagtgctcacaaaatagactattcgaagcgcagggattgtacaccgacagtcttt
aactttgatatcaggcgacccagtttagaacataggcaactcaattatatacaggtggat
ttggaagggggcagtgactctgacaaccctcagactccaaaaacgccgaccactcccctc
ccgcaaacccccacgcggcgcacagagctgtacgctgtgatagacattgagagaactgct
gctatgtccaacttgcagaaagcgctgcctcgagacgacggtacatctcggaagacgagg
cacaatagtactgacctgcccatgtga

DBGET integrated database retrieval system