KEGG   Mus musculus (mouse): 50706Help
Entry
50706             CDS       T01002                                 

Gene name
Postn, A630052E07Rik, AI747096, OSF-2, Osf2, PLF, PN
Definition
(RefSeq) periostin, osteoblast specific factor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Fasciclin
Motif
Other DBs
NCBI-GeneID: 50706
NCBI-ProteinID: NP_056599
MGI: 1926321
Ensembl: ENSMUSG00000027750
Vega: OTTMUSG00000029043
UniProt: Q62009
LinkDB All DBs
Position
3; 3 C
AA seq 811 aa AA seqDB search
MVPLLPLYALLLLFLCDINPANANSYYDKVLAHSRIRGRDQGPNVCALQQILGTKKKYFS
SCKNWYQGAICGKKTTVLYECCPGYMRMEGMKGCPAVMPIDHVYGTLGIVGATTTQHYSD
VSKLREEIEGKGSYTYFAPSNEAWENLDSDIRRGLENNVNVELLNALHSHMVNKRMLTKD
LKHGMVIPSMYNNLGLFINHYPNGVVTVNCARVIHGNQIATNGVVHVIDRVLTQIGTSIQ
DFLEAEDDLSSFRAAAITSDLLESLGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASE
ALMKYHILNTLQCSEAITGGAVFETMEGNTIEIGCEGDSISINGIKMVNKKDIVTKNGVI
HLIDEVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASSLKPDGEYTLLAPVNNAFSDDTL
SMDQRLLKLILQNHILKVKVGLSDLYNGQILETIGGKQLRVFVYRTAICIENSCMVRGSK
QGRNGAIHIFREIIQPAEKSLHDKLRQDKRFSIFLSLLEAADLKDLLTQPGDWTLFAPTN
DAFKGMTSEERELLIGDKNALQNIILYHLTPGVYIGKGFEPGVTNILKTTQGSKIYLKGV
NETLLVNELKSKESDIMTTNGVIHVVDKLLYPADIPVGNDQLLELLNKLIKYIQIKFVRG
STFKEIPMTVYRPAMTKIQIEGDPDFRLIKEGETVTEVIHGEPVIKKYTKIIDGVPVEIT
EKQTREERIITGPEIKYTRISTGGGETGETLQKFLQKEVSKVTKFIEGGDGHLFEDEEIK
RLLQGDTPAKKIPANKRVQGPRRRSREGRSQ
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggttcctctcctgcccttatatgctctgctgctgctgttcctgtgtgatattaaccct
gcaaatgccaacagttactatgacaaggtcctggctcacagccgcatcaggggtcgggat
cagggcccaaacgtctgtgccctccagcaaattctgggcaccaaaaagaaatacttcagc
tcctgtaagaactggtatcaaggtgctatctgcgggaagaaaaccactgtgctatatgaa
tgctgccctggctatatgagaatggaagggatgaaaggctgccccgcagtgatgcctatt
gaccatgtttatggcacgctgggcattgtgggagccactaccactcagcactactccgat
gtctcgaagctgagagaagagattgaaggaaaagggtcatacacgtacttcgcgccgagt
aacgaggcttgggagaacctggattctgacattcgcagaggactggagaacaatgtcaat
gttgagctactgaatgccttacacagccacatggttaataagagaatgttaaccaaggac
ctgaaacacggcatggttattccttcaatgtacaacaatctggggctttttattaaccat
tatcccaatggggttgtcactgtgaactgtgctcgagtcatccatgggaaccagattgcc
acaaatggtgtcgtccatgtcattgaccgtgtcctgacacaaattggtacctccatccaa
gacttccttgaagcagaagacgacctttcatcatttagagcagccgccatcacctctgac
ctcttggagtcccttggaagagatggtcacttcacgctctttgctcccaccaatgaagct
ttcgagaaactgccacgaggtgtcctagaaaggatcatgggagacaaagtggcttctgaa
gctctcatgaagtaccacatcctaaataccctccagtgctctgaggccatcactggagga
gccgtgtttgagaccatggaaggaaacactattgagatagggtgcgaaggggacagtatc
tccattaacggaatcaagatggtgaacaagaaagacattgtgactaagaatggtgtcatc
cacctgattgatgaagtcctcattcctgattctgccaaacaagttattgagctggctgga
aaacagcaaaccactttcaccgacctggtagcccaattaggcttggcatcctctctgaag
ccagatggagagtacaccttattagcacctgtgaacaatgcgttctctgatgacactctg
agcatggaccaacgccttcttaagctaattctgcaaaatcacatattgaaagtaaaagtt
ggccttagcgacctctacaatggacagatactggaaaccattggaggcaaacaactccga
gtctttgtgtatcggacggctatctgcatagaaaactcatgcatggtgagaggaagcaag
cagggaaggaatggtgccattcacatattccgagaaatcatccaaccagcagagaaatcc
ctgcacgacaagctgcggcaagacaagcgctttagcatcttcctcagcctccttgaagct
gcagatttgaaagatctcctgacacagcccggagattggaccttgtttgcaccaaccaat
gatgccttcaagggaatgactagcgaagaaagggagcttctgattggggataaaaatgct
ctccaaaacatcattctttatcacctgaccccaggggtttatattggaaagggattcgaa
cccggagtcactaatatcctgaagaccacacagggaagcaaaatctatctgaaaggagta
aacgaaacgcttctagtgaatgagttgaagtccaaagaatctgacatcatgacgacaaat
ggtgtcatccacgtcgtggacaaactcctctatccagcagatattccagttggaaatgat
cagctcttggaattactgaacaaactgataaaatacatccaaatcaagtttgttcgtggc
agcaccttcaaagaaatccccatgactgtctatagacctgcaatgacgaagatccaaatt
gaaggtgatcccgacttcaggctgattaaagaaggcgaaacggtgacagaagtgatccac
ggagagccagtcattaaaaagtacaccaaaatcatagatggagttcctgttgaaataact
gaaaaacagactcgggaagaacgaatcattacaggtcctgagataaaatataccaggatt
tccacaggaggtggagaaacaggagagaccttgcagaaattcttgcaaaaagaggtctcc
aaggtcacaaagttcattgaaggtggcgatggtcacttatttgaagatgaggagattaaa
agactgcttcagggagacacacctgcaaagaagataccagccaacaaaagggttcaaggg
cctagaagacgatcaagagaaggccgttctcagtga

DBGET integrated database retrieval system