KEGG   Mus musculus (house mouse): 50789
Entry
50789             CDS       T01002                                 
Symbol
Fbxl3, AU041772, AW212966, FBK, Fbl3a, Fbxl3a, Ovtm, Play68
Name
(RefSeq) F-box and leucine-rich repeat protein 3
  KO
K10269  F-box and leucine-rich repeat protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    50789 (Fbxl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50789 (Fbxl3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     50789 (Fbxl3)
SSDB
Motif
Pfam: F-box-like F-box DUF4116 F-box_5
Other DBs
NCBI-GeneID: 50789
NCBI-ProteinID: NP_056637
MGI: 1354702
Ensembl: ENSMUSG00000022124
UniProt: Q8C4V4 Q5PRF6
LinkDB
Position
14:complement(103317675..103337036)
AA seq 428 aa
MKRGGRDSDQDSAEEGTAEKPKRPRTTQERSQPCDWGNLLQDIVLHVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaacgaggaggaagagatagtgaccaggactctgctgaggaaggcactgccgagaag
cccaagagaccgaggacgacacaggagcgctcgcagccttgtgactggggtaacctcctg
caggacatcgtcctccatgtttttaagtatttgcctcttcttgaccgggctcatgcttcc
caagtgtgccggaattggaatcaggtatttcacatgcctgacttgtggcgatgttttgaa
tttgaactgaatcagccagcgacatcttacttgaaagccacacacccagagctgatcaaa
cagattatcaaaaggcactcaaaccacctacagtatgtcagcttcaaggtggacagcagc
aaagaatcagctgaagctgcttgtgacatactgtcgcagcttgtgaattgctctttaaaa
actctcggacttatctcgactgcccggccaagctttatggatctaccaaagtctcacttt
atctctgcactgacagttgtgtttgtaaactccaagtccctgtcctcacttaagatagac
gacaccccagtcgatgacccatcccttaaagtcctcgtggccaacaacagcgacacactc
aagctgttgaaaatgagcagctgtcctcacgtctctccagcaggcattctgtgtgtggct
gaccagtgtcatggcttacgagaactggccctgaactaccatttgctaagtgatgagttg
ttgctcgcactgtcttctgaaaagcatgttcgcttagaacatttgcgcattgatgttgtc
agtgagaacccgggacagacacacttccacactatccagaagagcagctgggatgccttc
atcaaacactcaccgaaagtcaacctagtgatgtatttttttttatacgaagaggaattt
gacccattctttcgttatgaaatacctgctacgcatctttactttgggagatcagtcagc
aaagatgtgcttggccgtgtgggcatgacctgcccgagactagtggaactggtagtgtgt
gccaatgggttgcggcctcttgatgaagagttaattcgcattgcggaacgttgcaaaaat
ttgtcagctattgggctgggggaatgtgaagtctcatgtagtgcctttgttgagtttgtg
aagatgtgtgggggccgcctgtctcagttatccattatggaagaagtgttaattcctgac
caaaagtatagtttggaacaaattcattgggaagtgtctaagcatcttggcagggtatgg
ttcccagacatgatgcctacttggtaa

DBGET integrated database retrieval system