KEGG   Mus musculus (house mouse): 53321
Entry
53321             CDS       T01002                                 
Symbol
Cntnap1, AI841080, Caspr, NCP1, Nrxn4, p190, shm
Name
(RefSeq) contactin associated protein-like 1
  KO
K07379  contactin associated protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    53321 (Cntnap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    53321 (Cntnap1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   53321 (Cntnap1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF
Other DBs
NCBI-GeneID: 53321
NCBI-ProteinID: NP_058062
MGI: 1858201
Ensembl: ENSMUSG00000017167
UniProt: O54991
LinkDB
Position
11:101065429..101081550
AA seq 1385 aa
MMSLRLFSILLATVVSGAWGWGYYGCNEELVGPLYARSLGASSYYGLFTTARFARLHGIS
GWSPRIGDPNPWLQIDLMKKHRIRAVATQGAFNSWDWVTRYMLLYGDRVDSWTPFYQKGH
NATFFGNVNDSAVVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGIYGCPYTSSILYFDG
DDAISYRFQRGASQSLWDVFAFSFKTEEKDGLLLHTEGSQGDYVTLELQGAHLLLHMSLG
SSPIQPRPGHTTVSLGGVLNDLSWHYVRVDRYGRDANFTLDGYAHHFVLNGDFERLNLEN
EIFIGGLVGAARKNLAYRHNFRGCIENVIYNRINIAEMAVMRHSRITFEGNVAFRCLDPV
PHPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSHLGDGLGHVELMLSEGQV
NVSIAQTGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTG
TSYFFGGCPKPASRWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRKLGYFAEVLFDTCG
ITDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGVTCHEPLYKESCEAYRLSGKYSGNYT
IDPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMDRPFLGAIQYWNASWEEV
SALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGL
DQSCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCY
GDRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPFCRWRRPYVR
VELNTSRDVVFAFDIGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLR
PMPLQTYIWLVYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTFPNCTG
HCTHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFETGTWMRYNLQSALRS
AAREFSHMLSRPVPGYEPGYVPGYDTPGYVPGYHGPGYRLPEYPRPGRPVPGYRGPVYNV
TGEEVSFSFSTNSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVT
DGQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQ
RYNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEAMRVQGELSESNCGAMPRLVSE
VPPELDPWYLPPDFPYYHDDGWIAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNE
PKATHDSHPGGKAPLPPSGPAQAPAPTPAPTQLPTPAPAPAPAPASGPGPRDQNLPQILE
ESRSE
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgatgagtctccggctcttcagcatcctgctcgccacggtggtctctggagcttggggc
tggggctactacggttgcaatgaggagctggtggggcctctgtatgcacggtctctgggc
gcttcttcctactatggactctttaccacagcccgctttgcccggctacatggcatcagt
ggatggtcgccccggattggggacccgaatccctggctgcagatcgacttaatgaagaag
catcggatccgggctgtggccacacagggagcttttaattcttgggattgggtcacacgt
tacatgctgctctacggggaccgtgtggacagctggacaccattctaccaaaaagggcac
aatgcgaccttcttcgggaatgtcaatgactcggcagtggtccgccatgaccttcactac
cactttacggctcgctacatccgcatcgtgccactggcctggaacccacgcggcaagatt
ggcctgaggctgggcatctatggttgtccctacacatccagcatcctgtattttgacggc
gacgatgccatctcataccgcttccagcgaggcgccagccaaagtctttgggacgtgttc
gcttttagtttcaagacagaggagaaggatgggctgttgctgcacaccgagggctcccag
ggggattatgtgacgcttgaactgcaaggggcgcacctgctgctgcacatgagcctgggc
agcagtcccatccagccaagacctggtcacaccacggtgagccttggtggcgttcttaac
gacctaagctggcactatgtgcgggtggatcgatatggccgagatgcaaatttcaccctg
gatggttacgcccatcactttgtgctcaacggcgactttgaaaggctgaatcttgaaaat
gagatattcatcgggggtctagtgggcgcagcccgtaagaacctggcctaccgccataac
ttccgtggctgcatagaaaacgtgatctacaaccggatcaacattgcagaaatggcagtg
atgcgccattcgcggatcacctttgagggtaatgtggctttccgttgcttggatcccgtt
ccacaccccatcaacttcggaggccctcacaacttcgtccaagtgcctggctttccacgc
cgaggacgcttagccgtctcttttcgtttccgcacctgggacctcacagggctgctcctt
ttctcccacttgggggacgggctgggtcatgtggagctgatgcttagcgaagggcaagtg
aatgtatccatcgcgcagactggccgcaagaagcttcagtttgctgctgggtaccgcctg
aatgatggcttctggcacgaggtgaactttgtggcacaggaaaaccatgcagtcatcagt
attgatgatgtggaaggggcagaggtcagggtttcatacccactgctgatccgcacaggg
acttcatacttctttggtggttgtcccaaaccagccagtcgatggggctgccactccaac
cagacagcattccatggctgcatggagctgctcaaggtggacggtcaactggtcaacctc
actctggtagagtttcggaagctcggttattttgctgaggtcctctttgacacatgtggc
atcacagacagatgcagccctaacatgtgtgagcatgacggacgatgctaccagtcttgg
gatgacttcatctgctactgcgaacttaccggctacaagggagttacctgccacgaacca
ttgtacaaggagtcctgtgaggcctatcggctcagtgggaaatattctggaaactacacc
attgatcctgatggcagtggacccctgaagccgtttgtggtgtattgtgacatccgagag
aaccgagcgtggacagttgtgcggcatgacaggctgtggaccactcgagtgactggttcc
agcatggaccggccctttctgggggccatccaatactggaatgcctcctgggaggaagtc
agcgctctggccaatgcttcccaacactgtgagcagtggatcgagttttcctgctacaat
tcccggctgctcaacactgcaggaggctacccctacagcttttggattggccgcaatgag
gaacagcatttctactggggaggctcccagcctgggatccagcgctgtgcctgtgggctg
gaccagagctgtgtggaccctgcactgcactgcaattgtgatgccgaccagccacagtgg
agaacagacaaggggctcctgacctttgtagaccatctgcctgtcactcaggtagtggta
ggtgatacaaaccgctcaaattctgaagctcagttcttcctgaggcctctgcgctgctat
ggtgaccgcaattcctggaacaccatctccttccacactggagctgcactgcgtttccct
ccgatccgagccaaccacagcctcgatgtctcattctacttcaggacctcggctccctcg
ggtgtcttcctagagaacatggggggtcctttctgccggtggcgccgaccttacgtgaga
gtggagctcaacacatcccgggatgtggtctttgcctttgatattggcaatggggatgag
aacctgacagtgcactcggatgactttgagtttaacgatgatgagtggcatttggtccga
gctgaaatcaacgtgaagcaggcccggctgcgagtggatcaccggccctgggtgctaagg
cccatgcccctgcagacctacatctggctggtgtatgaccaacccctctatgtgggatct
gcagagcttaagaggcgcccttttgtgggctgcttgagggccatgcgtttgaatggagtg
actctgaacttggagggccgtgccaatgcctctgagggcaccttccccaactgcaccggc
cactgcacccacccccggttcccctgtttccacggaggacgctgtgtggagcgatacagc
tactacacatgtgactgtgacctcacagcttttgatgggccatactgcaatcacgatatt
ggtggattctttgagaccggcacatggatgcgctataacctccagtcagcactgcgctct
gcagcccgggagttctcacacatgctgagccggccagtgccgggctatgagcctggctat
gttccaggctacgacactcctggttacgtgcctggataccacggccctgggtaccgactg
cccgagtacccgaggcccggccggccagtgcccgggtatagggggcctgtctacaatgtt
actggagaggaggtctccttcagcttcagcaccaactctgctcctgccgtcctgctctat
gtcagctcctttgtacgtgactacatggctgtgctcatcaaggaagacgggaccctacag
cttcggtatcagttgggcaccagtccctatgtgtaccagctaaccacccggccagtgact
gatggtcagccccatagtgtcaacatcacccgggtctaccgaaacctctttatccaggtg
gactacttcccgctgacagaacagaagttctctctcctggtggacagccagctggactca
cccaaggccttgtatctagggcgtgtgatggagacaggagtcattgacccagagattcag
cggtacaacaccccaggtttctcaggctgcctgtctggtgtccggttcaacaatgtggct
cctctcaagacccatttccgaacccctcggcccatgactgctgagctggcggaggccatg
cgggttcaaggagaactgtcagaatctaactgtggagctatgccacgccttgtctctgag
gtgccaccagaacttgatccctggtacctgcctccagatttcccatactaccatgacgac
ggatggattgccatactcttaggttttttggtggccttcctgctgctggggcttgtggga
atgctggtgctgttctatctgcaaaatcatcgatacaagggctcctaccacaccaacgag
cccaaggccacccacgattcccatcctggcggcaaagctcccctccctccctcaggccct
gcccaggcccctgcccctactccagctcccacacagcttccaaccccagccccagcccca
gccccagccccagcctctggcccaggccccagagaccagaacctcccccagatcttggag
gagtccaggtctgaatga

DBGET integrated database retrieval system