KEGG   Mus musculus (mouse): 56338Help
Entry
56338             CDS       T01002                                 

Gene name
Txnip, 1200008J08Rik, AA682105, Hyplip1, THIF, Tbp-2, VDUP1
Definition
(RefSeq) thioredoxin interacting protein
  KO
K20910  thioredoxin-interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    56338 (Txnip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C Vps26
Motif
Other DBs
NCBI-GeneID: 56338
NCBI-ProteinID: NP_001009935
MGI: 1889549
Ensembl: ENSMUSG00000038393
Vega: OTTMUSG00000021271
UniProt: Q8BG60
LinkDB All DBs
Position
3 F2.1; 3 41.93 cM
AA seq 397 aa AA seqDB search
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYG
CVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVS
VSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRG
NHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLLIYVSVPGSKKVILDLPLVIGSR
SGLSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDIIPEDHRLESPTTPLLDDVDDSQ
DSPIFMYAPEFQFMPPPTYTEVDPCVLNNNNNNNNVQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgttcaagaagatcaagtcttttgaggtggtcttcaacgaccccgagaaggtg
tacggcagcggggagaaggtggccggacgggtaatagtggaagtgtgtgaagttacccga
gtcaaagccgtcaggatcctggcttgcggcgtggccaaggtcctgtggatgcaagggtct
cagcagtgcaaacagactttggactacttgcgctatgaagacacacttctcctagaagag
cagcctacagcaggtgagaacgagatggtgatcatgaggcctggaaacaaatatgagtac
aagttcggcttcgagcttcctcaagggcccctgggaacatcctttaaaggaaaatatggt
tgcgtagactactgggtgaaggcttttctcgatcgccccagccagccaactcaagaggca
aagaaaaacttcgaagtgatggatctagtggatgtcaatacccctgacctaatggcacca
gtgtctgccaaaaaggagaagaaagtttcctgcatgttcattcctgatggacgtgtgtca
gtctctgctcgaattgacagaaaaggattctgtgaaggtgatgacatctccatccatgct
gactttgagaacacgtgttcccgaatcgtggtccccaaagcggctattgtggcccgacac
acttaccttgccaatggccagaccaaagtgttcactcagaagctgtcctcagtcagaggc
aatcacattatctcagggacttgcgcatcgtggcgtggcaagagcctcagagtgcagaag
atcagaccatccatcctgggctgcaacatcctcaaagtcgaatactccttgctgatctac
gtcagtgtccctggctccaagaaagtcatccttgatctgcccctagtgattggcagcagg
tctggtctgagcagccggacatccagcatggccagccggacgagctctgagatgagctgg
atagacctaaacatcccagataccccagaagctcctccttgctatatggacatcattcct
gaagatcacagactagagagccccaccacccctctgctggacgatgtggacgactctcaa
gacagccctatctttatgtacgcccctgagttccagttcatgcccccacccacttacact
gaggtggatccgtgcgtccttaacaacaacaacaacaacaacaacgtgcagtga

DBGET integrated database retrieval system