Mus musculus (house mouse): 56438 Help Entry 56438             CDS       T01002                                  Symbol Rbx1, 1500002P15Rik, AA517855, ROC1 Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mmu  Mus musculus (house mouse) Pathway mmu03420   Nucleotide excision repair mmu04066   HIF-1 signaling pathway mmu04110   Cell cycle mmu04114   Oocyte meiosis mmu04120   Ubiquitin mediated proteolysis mmu04141   Protein processing in endoplasmic reticulum mmu04310   Wnt signaling pathway mmu04350   TGF-beta signaling pathway mmu04710   Circadian rhythm mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     56438 (Rbx1)    04120 Ubiquitin mediated proteolysis     56438 (Rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     56438 (Rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     56438 (Rbx1)    04350 TGF-beta signaling pathway     56438 (Rbx1)    04066 HIF-1 signaling pathway     56438 (Rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     56438 (Rbx1)    04114 Oocyte meiosis     56438 (Rbx1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     56438 (Rbx1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     56438 (Rbx1)   09162 Cancer: specific types    05211 Renal cell carcinoma     56438 (Rbx1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     56438 (Rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mmu04121]     56438 (Rbx1)    03400 DNA repair and recombination proteins [BR:mmu03400]     56438 (Rbx1) Enzymes [BR:mmu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      56438 (Rbx1) Ubiquitin system [BR:mmu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    56438 (Rbx1)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      56438 (Rbx1)    Cul2 complex      56438 (Rbx1)    Cul3 complex      56438 (Rbx1)    Cul4 complex      56438 (Rbx1)    Cul7 complex      56438 (Rbx1)    Cul9 complex      56438 (Rbx1) DNA repair and recombination proteins [BR:mmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       56438 (Rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       56438 (Rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 Motif Other DBs NCBI-GeneID:  56438 NCBI-ProteinID:  NP_062686 MGI:  1891829 Ensembl:  ENSMUSG00000022400 UniProt:  P62878 Structure PDB LinkDB All DBs Position 15:81350517..81360570 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatggatgtggatacccccagcggcaccaacagcggcgcgggcaagaag cgctttgaagttaaaaagtggaatgcagtggccctctgggcctgggacattgtggttgat aactgtgccatctgcaggaaccacattatggatctttgtatcgaatgtcaggccaaccag gcgtcagctacttccgaagagtgtacggttgcatggggagtctgcaaccatgcttttcat ttccactgcatctctcgatggctcaaaacgaggcaggtgtgtccgttggacaacagagag tgggagttccagaagtatgggcattag

DBGET integrated database retrieval system