KEGG   Mus musculus (house mouse): 56613
Entry
56613             CDS       T01002                                 
Symbol
Rps6ka4, 1110069D02Rik, 90kDa, AI848992, Msk2, mMSK2
Name
(RefSeq) ribosomal protein S6 kinase, polypeptide 4
  KO
K16510  ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    56613 (Rps6ka4)
   04668 TNF signaling pathway
    56613 (Rps6ka4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    56613 (Rps6ka4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56613 (Rps6ka4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   56613 (Rps6ka4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Pkinase_fungal Haspin_kinase Kdo RIO1 Pkinase_C TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 56613
NCBI-ProteinID: NP_064308
MGI: 1930076
Ensembl: ENSMUSG00000118668
UniProt: Q9Z2B9
LinkDB
Position
19:complement(6806573..6819513)
AA seq 773 aa
MGDEDEDEGCAVELQITEANLTGHEEKVSVENFALLKVLGTGAYGKVFLVRKTGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKAGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPLRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVKSHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPAGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMADVLQAPGAGYRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEENTQREVAALRLCQSHPNVVNLHEVLHDQLHTY
LVLELLRGGELLEHIRKKRLFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPAEPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRSSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSAAASRRGSPVPASSGRLPASAAKGTTRRANGPLSPS
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgggagacgaggatgaggacgagggctgcgccgtggagctgcagatcaccgaagccaac
ctcaccgggcatgaggagaaggtgagcgtggagaacttcgcgctgctcaaggtgctgggc
acgggagcctatgggaaggtgttcctggtgcggaagacgggtgggcacgacgcgggcaag
ctctatgccatgaaggtgctacgcaaggcggcgttggtgcagcgcgcgaagacacaggag
catacccgcaccgaacgctcggtgctggagctggttcgccaagcacccttcctggtcaca
ctgcactacgccttccagacggatgccaagctgcacctcatcctggactacgtgagcggt
ggtgagatgttcactcacctctaccagcgccagtacttcaaggaggctgaggttcgagtg
tatgggggcgagattgtgctggccctggaacacctgcacaagctgggtatcatctaccgg
gacctgaagctggagaacgtcttacttgactcagaaggtcacatcgtccttacagacttt
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcaca
atcgagtacatggctcccgaaatcatccgaagcaaggctggacatggcaaggctgtggac
tggtggagcctgggtatcctgctcttcgagctgctgacaggggcctcacccttcacactg
gagggagagaggaacactcaggctgaggtgtcccgacggatcttgaagtgctcccctccc
ttccctctccggattgggcctgtggcacaggacctgctacagcggctgctgtgcaaggac
cctaagaagaggttgggcgcaggtccccagggtgcgcaggaagtcaagagtcaccccttc
ttccagggtctggactgggtggctctggctgccagaaagatcccagccccattccggccc
cagatccgctcagagctggatgtggggaattttgcggaggaattcacccggctggagccc
gtctactcccctgcaggcagccctccacctggggaccctcggatctttcagggatactcc
ttcgtggctccgtccatcctctttgaccacaacaatgcagtgatggctgatgtactgcag
gcaccgggtgccggatacaggcccggcagggcagcagttgccaggagtgccatgatgcag
gactcgcctttcttccagcagtacgaactggaccttcgggagccagcgctggggcagggc
agcttctctgtgtgtcggagatgtaggcagcgccagagcggccaggagtttgctgtcaag
atcctcagccgcaggctggaggagaacactcagcgagaggtggctgctcttcgcctgtgc
cagtcacaccccaacgtggtgaatctgcatgaggtgcttcatgaccagctacacacttac
ctggtcctggagttgctgcgaggcggagagctattggaacacatccgcaagaagcggctc
ttcagcgagtcggaggccagccagatccttcggagcctggtttcggccgtgagcttcatg
cacgaggaggcaggcgtggtgcaccgcgacctgaaacccgagaacatcttgtacgcggac
gacactcccggggccccggtgaagatcatcgacttcgggttcgcgcgactgcggccccag
agcccggcagagcccatgcagactccttgcttcacactgcagtacgctgcacccgagctg
ctggcacagcagggctacgatgagtcctgcgatctatggagcctgggtgtcattctgtac
atgatgctgtctggccaggttcccttccaaggggcctccggccagggtggacagagtcag
gcagctgagatcatgtgcaagatccgtgaagggcgcttctccctggacggggaagcctgg
caaggtgtgtcggaggaagccaaggagctggtccgagggctactgacagtcgaccccgcc
aagcggctgaagctggaggggctgcgtagcagctcgtggcttcaggacggcagcgcgcgc
tcctcgcccccgctccgcacgccggatgtgctggagtcctctgggccagctgtgcgttcc
gggctcaatgccactttcatggcgttcaaccgaggcaagcgcgagggcttctttctcaag
agtgtagagaatgcgcctctggccaagaggcgcaagcagaagctccggagcgcggccgcc
tcccgccgaggctccccagtgcctgcctcctccggtcgcctaccagcctctgccgctaag
gggacaactcgccgagccaacggccccttgtccccttcctag

KEGG   Mus musculus (house mouse): 73086
Entry
73086             CDS       T01002                                 
Symbol
Rps6ka5, 3110005L17Rik, 6330404E13Rik, AI854034, MSK1, MSPK1, RLPK, RLSK, S6K-alpha-5
Name
(RefSeq) ribosomal protein S6 kinase, polypeptide 5
  KO
K04445  ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04713  Circadian entrainment
mmu04722  Neurotrophin signaling pathway
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    73086 (Rps6ka5)
   04668 TNF signaling pathway
    73086 (Rps6ka5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    73086 (Rps6ka5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    73086 (Rps6ka5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    73086 (Rps6ka5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    73086 (Rps6ka5)
   05206 MicroRNAs in cancer
    73086 (Rps6ka5)
  09162 Cancer: specific types
   05219 Bladder cancer
    73086 (Rps6ka5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    73086 (Rps6ka5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     73086 (Rps6ka5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   73086 (Rps6ka5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like ABC1 APH Pkinase_C Pkinase_fungal RIO1 Haspin_kinase Choline_kinase SR-25
Other DBs
NCBI-GeneID: 73086
NCBI-ProteinID: NP_705815
MGI: 1920336
Ensembl: ENSMUSG00000021180
UniProt: Q8C050 Q3TUH8
LinkDB
Position
12:complement(100514692..100691693)
AA seq 863 aa
MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYG
KVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAF
QTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLE
NILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWSL
GVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSTVAKDLLQRLLMKDPKKR
LGCGPRDAEEIKEHLFFEKIKWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSP
AALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTNVARSAMMKDSPFYQ
HYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNI
VKLHEVFHDQVAASAQPPGQVVLCSLLLLALLFNRSLTRKPVTWTWLVHSTSQLPPLPPP
MPEIVLFILLSDNGQLHTFLVMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMH
DVGVVHRDLKPENLLFTDENDNLEIKVIDFGFARLKPPDNQPLKTPCFTLHYAAPELLTH
NGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNV
SQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVK
ATFHAFNKYKREGFCLQNVDKAPLAKRRKMKRTSTSTETRSSSSESSRSSSSQSHGKTTP
TKTLQPSNPTEGSNPDTLFQFSD
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggagggggagggcggcggcagcggcggcgcgggcaccagcggggacagcggcgacggc
ggcgagcagctccttactgtcaagcacgagctgcggaccgccaacttaacaggacacgca
gagaaggtggggattgaaaactttgagctgctgaaggtcctaggaactggagcttatggg
aaagtatttctagttcgtaaaataagcggccatgatgctggaaagctgtatgctatgaag
gttttaaaaaaggcaacaatagttcagaaggctaaaactacagagcatacaaggacagaa
cgacaggttctggagcacattagacagtcgccatttttggtgacattgcactatgctttc
cagacagagaccaagcttcatctcatcttagattatataaatggtggagaactttttact
catctttctcaaagagagcgtttcacagagcacgaagtgcagatctatgttggagagatt
gtgcttgccctggaacacctgcacaagttggggattatataccgtgacattaagcttgaa
aatattctcctggattctaacggccatgtggtgctgacagatttcggtctgagtaaggag
tttgtggccgatgaaactgaaagagcatattctttttgtggaactattgaatacatggct
ccagatattgtcagagggggtgattcgggacacgacaaggcagttgactggtggagctta
ggtgttctaatgtatgagctactaactggagcatctcctttcactgtcgatggagaaaaa
aattcccaggctgagatatctaggagaattttaaaaagtgagcctccgtatccccaggaa
atgagcacagtagctaaagacctacttcagcgtctcttgatgaaagatcccaagaagcga
ttgggatgtggcccacgggatgcagaagaaatcaaagaacatctcttctttgagaagata
aagtgggatgacttagctgccaaaaaagtgcctgcgccattcaagccggtgatccgggat
gagttagatgtgagtaacttcgctgaagagttcacagagatggaccccacctactctccc
gctgccttgccacagagctccgagcgactgtttcagggctattccttcgttgctccatct
attctcttcaagcgtaacgcagctgtcatagatcctcttcagttccatatgggagttgac
cgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactcacccttctatcaa
cactatgacctagatctgaaggacaaacctttgggagaaggaagtttttcaatttgtcgc
aagtgtgtacacaaaaaaactaaccaagcatttgctgtcaaaataatcagcaaaaggatg
gaagccaatactcagaaagaaataacagctctgaaactctgcgaaggacaccccaatatt
gtgaaactacatgaagtttttcacgatcaggtggcagcgtctgctcagcccccaggacag
gttgttctatgctctcttctactcttagctctgcttttcaacagaagtctcacacggaag
cctgtcacttggacatggctggtccatagcacctctcagctccctccattgccacctccc
atgcctgaaattgtgctatttattcttctctctgataatggacagcttcatacgtttctt
gtgatggaacttctgaatggcggagagctgttcgagcgcatcaagagaaagaagcacttc
agcgagactgaggccagctacatcatgcggaagcttgtgtcagctgtgagccacatgcac
gatgtaggagtggtgcacagagatctgaagcctgagaatctgttgttcactgatgaaaac
gacaatttggaaattaaagtgattgactttgggtttgcacgcctcaagccacctgacaat
cagcccctcaagaccccgtgcttcaccctccactacgcagcaccggagctcttgacgcac
aatggctacgatgagtcctgtgacctgtggagcttgggtgtcatcctgtatacaatgctg
tcagggcaggtgccattccagtctcatgacagaagtttaacatgcaccagtgcagtggaa
atcatgaagaaaattaaaaagggagacttctcctttgaaggagaagcgtggaagaatgta
tcccaagaggctaaagatttgattcaagggcttcttacagttgatccaaataaaaggctg
aaaatgtctggtttgagatacaatgaatggcttcaggatggcagtcagctgtcctccaat
cctctgatgactccagacattctgggatcgtcaggagcagctgtgcacacctgtgtgaaa
gcaacctttcatgcctttaacaagtataagagagaaggattttgcctgcagaatgtggat
aaggcccctttggctaagaggaggaaaatgaagaggaccagcaccagcacagagactcgc
agcagctccagcgagagctcccgctcctcctcctcccagtcccacggcaagacaacgcct
accaagacgctgcagcccagcaatcccaccgaaggcagtaacccagacaccctcttccag
ttctcagactga

DBGET integrated database retrieval system