KEGG   Mus musculus (house mouse): 56838
Entry
56838             CDS       T01002                                 
Symbol
Ccl28, CCK1, MEC, Scya28
Name
(RefSeq) chemokine (C-C motif) ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    56838 (Ccl28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    56838 (Ccl28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    56838 (Ccl28)
   04062 Chemokine signaling pathway
    56838 (Ccl28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    56838 (Ccl28)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   56838 (Ccl28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 56838
NCBI-ProteinID: NP_064675
MGI: 1861731
Ensembl: ENSMUSG00000074715
UniProt: Q9JIL2
LinkDB
Position
13:120085355..120115895
AA seq 130 aa
MQQAGLTLMAVAVCVAFQTSEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDL
AAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRT
RGTHRHEASR
NT seq 393 nt   +upstreamnt  +downstreamnt
atgcagcaagcagggctcacactcatggctgtggctgtgtgtgtggcttttcaaacctca
gaagccatacttcccatggcctccagctgttgcactgaggtgtctcatcatgtttccgga
agacttctggaaagagtgagttcatgcagcatccagagagctgacggggactgcgacctg
gctgctgtcatccttcatgttaaacgtagaagaatctgcatcagcccgcacaatcgtact
ttgaagcagtggatgagagcctcagaggtaaagaagaatggcagagaaaacgtatgttct
gggaaaaaacaacccagcaggaaggacagaaaagggcacactacgagaaagcacagaaca
cgtggaacacacaggcacgaagcctctcgttag

DBGET integrated database retrieval system