KEGG   Mus musculus (mouse): 58809Help
Entry
58809             CDS       T01002                                 

Gene name
Rnase4, C730049F20Rik, Rab1
Definition
(RefSeq) ribonuclease, RNase A family 4
  KO
K16632  ribonuclease 4 [EC:3.1.27.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    58809 (Rnase4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     58809 (Rnase4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     58809 (Rnase4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 58809
NCBI-ProteinID: NP_067447
MGI: 1926217
Ensembl: ENSMUSG00000021876
UniProt: Q8C7E4
LinkDB All DBs
Position
14; 14 C1
AA seq 148 aa AA seqDB search
MMDLQRTQSLLLLLVLTLLGLGLVQPSYGQDRMYQRFLRQHVDPQVTGGNDNYCNVMMQR
RKMTSVQCKRFNTFIHEDIWNIRGICSTTNILCKNGQMNCHEGVVKVTDCRETGNSKAPN
CRYRARTSTRRVVIACEGDPEVPVHFDR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctacagaggactcagtccttgcttctgctcttggtgctgaccctgctgggg
ttagggcttgtacagccctcctatggccaggatcgaatgtaccaacggttccttcgacag
catgtggaccctcaggtgacaggtggcaatgacaactactgcaacgtgatgatgcagaga
cggaagatgacttctgtccagtgcaaacgcttcaacaccttcatccacgaagacatctgg
aacattcgtggcatctgcagtaccaccaatatcctgtgcaagaacggccagatgaactgt
cacgaaggtgtagtgaaggtcacggactgcagagagacagggaactccaaggcccccaac
tgtagatacagggcaagaaccagcactaggcgagttgtcattgcctgtgagggtgaccca
gaggtcccagtgcactttgacagatag

DBGET integrated database retrieval system