KEGG   Mus musculus (house mouse): 66797
Entry
66797             CDS       T01002                                 
Symbol
Cntnap2, 5430425M22Rik, Caspr2, mKIAA0868
Name
(RefSeq) contactin associated protein-like 2
  KO
K07380  contactin associated protein-like 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    66797 (Cntnap2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    66797 (Cntnap2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   66797 (Cntnap2)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C Laminin_G_3 COLFI EGF hEGF Syndecan
Other DBs
NCBI-GeneID: 66797
NCBI-ProteinID: NP_001004357
MGI: 1914047
Ensembl: ENSMUSG00000039419
UniProt: Q9CPW0 E9QNF7
LinkDB
Position
6:45036995..47278330
AA seq 1332 aa
MVMSLRAGYRAALSLWILSSFICRAWTAPSTFQKCDEPLISGLPHVSFSSSSSLSSSYAP
GYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDT
GRNWKPYHQDGNIWAFPGNVNSDSVVRHDLQHAVVARYVRVVPLDWNGEGHIGLRAEVYG
CAYWADVINFDGHGVLPYRFRNKKMKTLKDVIALKFKTSESEGVLLHGEGQQGDYITLEL
KKAKLVLSLNLGSNQLGPIYGHTSVTSGSLLDDHHWHSVLIERQGRSINLTLDRSMQHFR
TNGEFDYLDLDYEITFGGIPFSGKPSSSNRKNFKGCMESINYNGVNITDLARRKKLEPSN
MGNLSFSCVEPYTVPVFFNATSYLEVPGRLNQDLFSVSFQFRTWNPSGLLLFSHFADNLG
NVEIDLVESKVGVHINNTQTKTSQIDISSGSGLNDGQWHEVRFLAKENFAVLTIDGDEAS
AVRTNSPLQVKTGEKYFFGGFLNHMNNASYSALQPSFQGCMQLIQVDDQLVNLYEVAHRK
PGSFANVTIDMCAIIDRCVPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCE
AYKHLGQTSNYYWIDPDGSGPLGPLKVYCNMTEDKVWTIVSHDLQMQTTVVGYNPEKYSV
TQLIYSASMDQISAITSSAEYCEQYVSYFCRMSRLLNTPDGSPYTWWVGKANEKHYYWGG
SEPGIQKCACGIERNCTDPKYYCNCDADYKQWRKDAGFLSYKDHLPVSQVVVGDTDRQGS
EAKLSVGPLRCQGDRNYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLIPRGVFLENL
GNTDFIKLELKSATEVSFSFDVGNGPVEIVVRSPSPLNDDQWHRVTAERNVKQASLQVDR
LPQQIRKAPTEGHTRLELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFK
SGCSGHCTSYGANCENGGKCIEKYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQ
APAVTARDTGSRAENSADQQQHLAPDLAQEQIHFSFSTTKAPCILLYVSSLTTDFLAVLV
KPTGNLQIRYNLGGTREPFNIDVDHRNMANGQPHSVNITRHERTIILKLDHYPAVGYHLP
SSSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNHIAPLKAALRQTNA
SAHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNR
NSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFT
ETIDESKKEWLI
NT seq 3999 nt   +upstreamnt  +downstreamnt
atggtgatgtctctgagagcaggctacagggcagcgctctcgctctggattctcagcagc
ttcatctgcagagcctggacagctccctccacgttccaaaaatgtgatgagcctctcatc
tctggtcttccccatgtgtccttcagcagctcttcctccctgtccagcagctatgcacct
ggttatgccaagattaataaacgaggaggtgctgggggatggtctccatcagacagtgac
cactatcaatggcttcaggttgattttggtaatcggaagcagatcagtgccattgcaacc
caaggaaggtacagcagttctgattgggtgacacaatatcgaatgctctacagtgacaca
gggagaaactggaaaccctatcatcaagatggcaatatctgggcttttccaggaaacgtc
aattctgacagcgtggtccgacacgacctgcagcatgcagtagttgcccgttatgtacgc
gttgtgcccttggactggaatggagaaggtcacatcgggctgcgtgcggaagtctatggc
tgcgcctactgggctgacgttatcaactttgatggccacggtgtgttaccatatcgattc
agaaacaagaagatgaaaacactcaaagatgttattgctttgaaatttaagacctctgaa
agtgaaggagtacttttgcatggtgaaggacagcaaggggattacattactttggaactg
aaaaaagcaaagctggtcctcagtttaaatctaggaagcaaccagcttggccccatctat
ggccacacatctgtgacatctgggagcctgctggatgatcaccactggcactctgtactc
attgagcgccagggacgcagcattaacttgaccctggacaggagcatgcagcattttcgc
accaatggagagtttgactacctggacttggactatgagataacatttggaggcatacct
ttctctggtaagccaagttccagtaataggaagaacttcaagggctgcatggaaagcatc
aactacaatggtgtcaatattaccgatcttgcccgaagaaagaaattagagccatcaaat
atggggaatctgagtttctcttgtgtggagccctatacagtaccagtcttcttcaatgct
acaagctacctggaggtacctggcagacttaatcaggacctgttctcagtcagtttccag
tttaggacttggaaccccagcggtctcttgctcttcagtcactttgcagataacttgggc
aatgtggagattgaccttgtagagagcaaagtgggcgtccacataaacaacacacagacc
aagacaagccaaattgacatctcctcaggctccgggctgaatgatgggcagtggcatgag
gttcgcttcctggccaaggaaaacttcgcagtcctcaccattgatggagatgaagcatca
gcagttcggaccaatagtcctcttcaagtgaagactggcgagaaatacttctttggagga
tttctgaaccacatgaacaatgccagctactctgcccttcagccatcattccaaggatgc
atgcagctcattcaggtagatgaccagcttgtgaatttatacgaagtagcacacaggaag
ccaggaagcttcgcaaatgtcaccattgacatgtgtgccatcatagacagatgtgtgccc
aatcactgtgagcatggtggaaagtgctcgcaaacatgggacagcttcaaatgcacttgt
gatgagacaggatacagcggggccacctgccacaactccatctacgagccctcctgtgaa
gcatacaaacaccttggccagacatcaaattactactggatagatcctgatggcagtgga
ccactggggcctctgaaggtttattgcaacatgacagaggacaaggtgtggaccatagtg
tctcatgacttacagatgcagacgacagtggtaggctacaacccagaaaagtactctgtg
acacagcttatctacagtgcctccatggaccagattagtgccatcaccagtagcgccgag
tactgcgaacagtacgtctcctacttctgcaggatgtccaggttgttgaacaccccagat
ggaagtccttacacctggtgggttggcaaagccaatgagaagcactactactggggagga
tcagagcctggaattcagaagtgtgcctgtggcatagagcgcaactgcacagatcccaag
tactactgcaactgtgatgctgactacaagcagtggaggaaggatgctggcttcttatcc
tacaaagatcacctgccagtgagccaggtggtggttggagatactgaccgacaaggctca
gaagccaagctgagtgtgggtcccctgcgctgccaaggagacagaaattattggaatgct
gcctccttcccaaacccatcatcctacctgcacttctctaccttccaaggggaaacaagt
gctgacatttctttctacttcaagacattaatccccaggggagtatttttggaaaatctg
gggaacacagacttcatcaagctggagctcaagtctgccacagaagtgtccttttcattt
gatgttggaaacgggccagtggagatcgtggtgaggtcaccttcacctctcaatgatgac
cagtggcatcgggtcactgcagagaggaatgtcaagcaggccagtctccaggtggatcgc
ctgccccagcaaatccgaaaagccccgactgaaggtcatacccgcctggaactctacagt
cagctgtttgttggtggtgctggaggccagcagggcttcctaggctgcatccgctccttg
aggatgaatggagtaacacttgacttggaagaaagggcgaaggtcacatctgggttcaag
tctggatgctcaggccactgcaccagctatggggctaactgtgaaaatggaggcaaatgc
atcgaaaaataccatggctactcctgcgactgctctaacacagcctatgatgggacattc
tgcaacaaagatgttggtgccttttttgaagaaggcatgtggctgcgctataacttccag
gccccagcggtcactgccagagacacaggcagcagggccgagaattctgcagaccagcag
cagcacttggctccagatctggcccaggagcagatccactttagcttcagcactaccaag
gcaccctgcatcctcctctatgtcagctccctcaccactgacttcctagctgttctggtc
aagcccacaggaaacttgcagatccggtataacctgggaggaaccagagagccattcaat
attgacgtagaccacaggaacatggccaatggacagccgcacagtgtcaacatcacccgg
catgagaggaccataattctcaagctcgaccattatcctgctgtgggttaccatctaccc
agctcctctgatacgctcttcaattctcccaagtcgctcttccttggaaaagttatagaa
acgggaaaaatcgaccaagaaattcacaaatacaacaccccaggcttcacaggctgcctg
tccagagtccagttcaaccacatcgcccctctcaaggcagccttgagacagacaaacgcc
tcagcccacgtgcacattcagggtgagctggtggaatctaactgcggggcctccccactg
acgctttcccccatgtcttcagccactgacccttggcacctagatcacttggattcagcc
agtgctgatttcccatataacccaggacaaggccaagctataagaaatggagtcaacaga
aactcagctatcattggaggggtcatcgctgtggtgattttcaccatcctctgcaccctg
gtcttcctcatccggtacatgttccgtcacaagggcacctaccacaccaatgaggccaag
ggagctgagtcagccgagagtgcagatgctgccatcatgaacaacgaccccaacttcaca
gagaccattgacgagagcaaaaaggagtggctcatttga

DBGET integrated database retrieval system