KEGG   Mus musculus (house mouse): 69524
Entry
69524             CDS       T01002                                 
Symbol
Esam, 2310008D05Rik, Esam1, W117m
Name
(RefSeq) endothelial cell-specific adhesion molecule
  KO
K06787  endothelial cell adhesion molecule
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    69524 (Esam)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    69524 (Esam)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set Sema4F_C RTX Izumo-Ig Nitrate_red_gam
Other DBs
NCBI-GeneID: 69524
NCBI-ProteinID: NP_081378
MGI: 1916774
Ensembl: ENSMUSG00000001946
UniProt: Q925F2 Q3U102
LinkDB
Position
9:37439385..37449615
AA seq 394 aa
MILQAGTPETSLLRVLFLGLSTLAAFSRAQMELHVPPGLNKLEAVEGEEVVLPAWYTMAR
EESWSHPREVPILIWFLEQEGKEPNQVLSYINGVMTNKPGTALVHSISSRNVSLRLGALQ
EGDSGTYRCSVNVQNDEGKSIGHSIKSIELKVLVPPAPPSCSLQGVPYVGTNVTLNCKSP
RSKPTAQYQWERLAPSSQVFFGPALDAVRGSLKLTNLSIAMSGVYVCKAQNRVGFAKCNV
TLDVMTGSKAAVVAGAVVGTFVGLVLIAGLVLLYQRRSKTLEELANDIKEDAIAPRTLPW
TKGSDTISKNGTLSSVTSARALRPPKAAPPRPGTFTPTPSVSSQALSSPRLPRVDEPPPQ
AVSLTPGGVSSSALSRMGAVPVMVPAQSQAGSLV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgattcttcaggctggaacccccgagaccagcttgctgcgggttttgttcctgggactg
agtacccttgctgccttctcccgagctcagatggagttgcacgtgcccccgggcctcaac
aaattggaagcggtagagggagaagaagtggtgctccccgcctggtacacgatggcacgg
gaggagtcgtggtcccacccccgggaggtgcccatcctgatctggttcttggaacaagaa
gggaaggaaccaaaccaggtgttgtcttacattaatggagtcatgacaaataaacctgga
acagccctggtccactctatctcttcacggaatgtgtccctgcgcctgggggcactccag
gagggagactctgggacttaccgctgttctgtcaatgtgcagaatgatgaaggcaaaagt
ataggccacagcatcaaaagcatagagctcaaagtgctggttcctccagctcctccatcc
tgtagtttacagggtgtaccctatgtcgggaccaatgtgaccctgaactgcaagtcccca
aggagtaaacctactgctcagtaccagtgggagaggctggccccatcctcccaggtcttc
tttggaccagccttagatgctgttcgtggatctttaaagctcactaacctttccattgcc
atgtctggagtctatgtctgcaaggctcaaaacagagtgggctttgccaagtgcaacgtg
accttggacgtgatgacagggtccaaggctgcagtggtcgctggagcagttgtgggcact
tttgttgggttggtgctgatagctgggctggtcctgttgtaccagcgccggagcaagacc
ttggaagagctggccaatgatatcaaggaagatgccattgctccccggaccttgccttgg
accaaaggctcagacacaatctccaagaatgggacactttcttcggtcacctcagcacga
gctctgcggccacccaaggctgctcctccaagacctggcacatttactcccacacccagt
gtctctagccaggccctgtcctcaccaagactgcccagggtagatgaacccccacctcag
gcagtgtccctgaccccaggtggggtttcttcttctgctctgagccgcatgggtgctgtg
cctgtgatggtgcctgcacagagtcaggctgggtctcttgtgtga

DBGET integrated database retrieval system