KEGG   Mus musculus (mouse): 69993Help
Entry
69993             CDS       T01002                                 

Gene name
Chn2, 1700026N20Rik, 4930557O16Rik, ARHGAP3, Bch
Definition
(RefSeq) chimerin 2
  KO
K20630  chimaerin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69993 (Chn2)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    69993 (Chn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP C1_1 zf-RING-like FYVE_2
Motif
Other DBs
NCBI-GeneID: 69993
NCBI-ProteinID: NP_076032
MGI: 1917243
Ensembl: ENSMUSG00000004633
Vega: OTTMUSG00000023143
UniProt: Q80XD1 Q3V2R3
LinkDB All DBs
Position
6; 6 B3
AA seq 332 aa AA seqDB search
MCSQELWLENERKCAMVRKSKPSRKRQELLAIAFGVKVGLKGGFLWSPLKLFACSQISSL
VRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC
SKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSG
FTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAA
KISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLM
RPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtgctctcaggaactgtggctggaaaatgagagaaaatgtgctatggttcggaagtcc
aagcccagcaggaagcgccaagagctgctggccattgcatttggggtcaaggtggggctc
aaaggtggctttctctggtctcctctcaagctctttgcctgttcacagatctcttcactg
gtccgaagagctgccctcacacacaacgacaaccacttcaactatgagaagacacacaac
ttcaaggtgcacacattccggggcccacactggtgtgaatactgtgccaattttatgtgg
gggctcatcgcccagggagtccggtgttcagattgtgggttaaacgtacacaaacagtgc
tccaagcacgtccccaatgactgccagccagatctcaagaggatcaagaaagtgtactgc
tgtgacctcaccacgcttgtcaaagctcacaacactcagagacccatggtggtggacata
tgtattcgggaaattgaagcaagaggattaaagtcagaagggctttacagagtctctgga
ttcacagaacacattgaagatgtcaagatggcgtttgacagagatggtgaaaaggcggat
atctctgccaacatctacccagacataaacatcatcactggagccctgaaactgtacttc
cgagacttacccatccctatcatcacatatgacacctactccaaatttatagaggcagca
aaaatctccaatgcggatgagaggctggaagctgtccatgaggtcctgatgctgctgcct
cctgcccactatgagaccctgcgctacctgatgatccacctgaaaaaggttaccatgaat
gaaaaggacaatttaatgaatgccgaaaatctggggatcgtgtttgggcccaccctgatg
agaccccctgaggacagcaccctcaccaccctccatgacatgcggtaccaaaagctgatc
gtgcagattttaatagaaaacgaagatgttctgttttaa

DBGET integrated database retrieval system