KEGG   Mus musculus (mouse): 75547Help
Entry
75547             CDS       T01002                                 

Gene name
Akap13, 1700026G02Rik, 5730522G15Rik, 5830460E08Rik, AKAP-13, AKAP-Lbc, BRX, Ht31, LBC, PROTO-LB, PROTO-LBC
Definition
(RefSeq) A kinase (PRKA) anchor protein 13
  KO
K16529  A-kinase anchor protein 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    75547 (Akap13)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    75547 (Akap13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75547 (Akap13)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    75547 (Akap13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_16 RhoGEF PH C1_1 Prok-RING_1 RII_binding_1 Ank_2 C1_2
Motif
Other DBs
NCBI-GeneID: 75547
NCBI-ProteinID: NP_083608
MGI: 2676556
Ensembl: ENSMUSG00000066406
Vega: OTTMUSG00000034140
UniProt: E9Q394
LinkDB All DBs
Position
7; 7 D1
AA seq 2776 aa AA seqDB search
MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCTSTRKVSSDTLETIAP
GHDCCETVKVLLCASREGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSRDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHDGGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNKEGATPVSLALERGYHELHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESESHREPHGDSCTGHISKLMNIQQQLMKTNLKQMDNLMPLMV
TAQDSSCVPSVPETDGLFLPCVPEPSDHQHPPFEETKSTLCCQRSPGRMAESSCDLSSMV
EEENVICSHKKNKDVGRKGEEAEPASAMDSGSASHQDSCLQSVPDCGVKGREGLPSCGNR
NEVTGTNYSGVATCQQPLSSRSSVLQDAMVTEPDACQHSSGRELPDSSSTDVGAPEKAGE
LEHSLLTPDATTQNNKPQVGEGTKERLENSDSSTTETTAVQVLSEPMEKADITNHVFATS
AVGVNTPAEASPALSSEEIPTEKPGMETQERGCEGGTTSDQSSPVLPAAAIENKVLGGQE
PDTSIAGFCKTASPLDLTMPGPSSDGMPEQNSESHARPAQSLSGQALLCSTAEAGTPSAE
ATHQPSTVTSSGRLEECGSGKASLPESTMVQPSTQELCTTLCPEDPQADTVTSDTVKNTQ
KSVGVCHLCVSDAKNQGNGLKQDTPLTNVLEDVPRLPSVVSQTEKELAPDQVSPPASSFS
LASSPESESVTKDDALSLVPSQKEKGTATPQLHRTTACRDGPDGRDLSDTDKVGDGATDP
PPSSAVELRTSMGNTSPVGIGGEQEGSSPTATLEVLSDSLLHNVDKAALVSDFTLPEEGV
SVVVPESSTALGQDGKDRAMSCSSVKEDVHSSEMSREDQRTPPSGQEIPGLCEKPMSALC
AEEKAQQHTPSACLKTETKDIKEVAPQVSLLTEGGAAKSLVPPRTSLSADSKQKASSTEQ
SGSSLLPSGLPGASEALHCNQPSALDVVVENTQFQGETNACEVSRSAMEDVTVADASPAT
AEPRKKDASHCIKDIPISELLNQEKQMTPSLPEAFLDKGVTDLQEVITPEIEPLDCKRET
LEGTDLNCATSNSKETPIEKPMQPLARDLPTETGLSVINNNVPQADMKQVAQASIPAEES
NATTVSTQAADVPTRADSIEETATRIVEAVIRQVRASNALMAKVETQNPSLSSPETKQLE
NAYTESACAFLPGETPQIEKTHEDTTGQCGAETEEPEKIILPESAPGKQGKMPDTRTGDE
VDLLSRISAASEEEAVGNGAATPKMKQGPGTQAINRESWCAIEPCPEAASLLASKQSSEC
RSFIDVGLGTECASKEGMLQRVSGSESDLFHSPSDEMDSIIFPKPEEEQLLCDTTGSSSS
TDDTASLDRHSSHGSDVSLPQTSKLNRSRNHQSANGFFSPGVEAPESRESESEPAGSGEM
EEEEMDSITEVPANCSFLRSSMRSLSPFRRHSWGPGKNAASDAEMNQRSSMRALGHVVRR
PPIHRRSFSLEGLTGGGVGNKPSSSLEMSSANSSELRNPFGGEEQRNSLMSLSEEHLEPD
QRQHHRMFDQQTCYRSKQQGFNYCTSAISSPLTKSISLMTISHPGLDSSRPFHSTSANLT
ESITEENCNFLPPSPSKKNFEEKSGTKVSRTFSYIRNKMSSSKKSKEKEKEKDKIKEKEK
DSKEKEKDKKTLNGHTFSPIPIVGPISCSQCMKPFTNKDAYTCAGCGAFVHKGCRENLAS
CAKVKMKQPKGSLQAHDTSSLPTVIMRNKSSQPKERPRSAVLLADEATAAPMFTNRRSQQ
SVSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKICKVNESTESLTDEGVGTDMNE
GQLMGDFESDSKQLEAESWSRTVDSKFLKQQKKDVVKRQEVIYELMQTELHHIRTLKIMS
DVYSRGMMTDLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRI
GDVLVSQFSGESAERLKKTYGKFCGQHNQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRL
GIPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLTQSLSLVKDVIGAVDSKVASYEK
KVRLGEIYTKTDSKSIMRMKSGQMFAKEDLRRKKLVRDGSVFLKSTTGRLKEVQAVLLTD
ILVFLQEKDQKYVFASLDHKSTVISLKKLIVREVAHEEKGLFLISMGVKDPEMVEVHASS
REERNSWIQIIQDTINSLNRDEDEGIPSENEEEKKLLDTKARELKEQLQQKDQQILLLLE
EKEMIFRDMTECSTPLPEDCSPTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQSLVSG
SLGGTLGQSISSPVEQEVMAAPISLPRRAETFGGFDCHQMNASKGGEKEEGDDGQDLRRT
ESDSGLKKGGNGNLVFMLKRNSEQVVQSIVHLHELLSMLQGVVLQQDSYIEDQKLVLTEK
VLTRSASRPSSLIEQEKQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEAREQELRDRE
AKLAEREETVRRRQQDLERDREELQQKKGTYQCDLERLRAAQKQLEREQEQLRRDTERLS
QRQMDQNLCQVSNKHGRLMRIPSFLPNSDEFSSPSAPSVTKSGSLDSELSVSPKRNSISR
TQKDKGPFHILGSASQTKVPEGQSQAPSSTSTSTRLFGLSKPKEKKEKKKKSKGSRTQPG
DGPASEVPAEGEEIFC
NT seq 8331 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagtccacaacaagctccattatatggcgattgtgttgttacagtattgctt
gctgaagaggacaaagttgaagatgatgctattttttacttgatattttctggctctacc
ctctatcactgcacaagtacccggaaagtcagttctgatacgttggagacaattgctcct
ggtcacgactgctgtgagacagtgaaggtgctgctctgtgcttccagagagggccttcct
gtgtttgtagtcgctgaagaagacttccatttcgtccaggatgaggcgtatgatgcagct
cagttcctggcaaccagtgctggaaatcagcaggctctgaacttcacacggttcctcgat
cgatcaggacctccttctagagatgtgaactctctcgatgagaaggtggcactggcattc
agacacctgaagctgcctgcagaatggaacgtgttagggacagatcacactttgcatgac
ggtggccctcgggaaaccctgatgcactttgctgtgcggctgggactgctgcggttgaca
tggttcctgttacagaagccaggtggccgtggagctctcagcatccacaacaaggaaggg
gcaacgcctgtgagcctggcactggagcgaggttatcacgaacttcaccagcttctgact
gaggaaaatgcaggggagccagattcctggagcagcttatcctatgaaatcccttatggc
gactgttcagtgaggcaccatcgagaactggacatctacacattgacttctgaatccgag
tcacatcgtgaaccccatggagacagctgtactggacatatttctaaacttatgaatatc
caacagcagctgatgaaaacaaacttgaagcagatggacaatctcatgccattaatggtg
acagcacaagattcgtcttgtgtgcccagtgtaccagagacagatggcctattccttccc
tgtgtaccagagccttctgaccaccagcatcctccttttgaagaaactaagagcactctg
tgctgccaaaggagtcctgggaggatggctgaaagttcctgtgatttgtcaagcatggtt
gaggaagaaaatgtcatctgttctcataagaaaaataaagatgtggggagaaagggggaa
gaggcggagccagcatctgccatggactccgggtctgcatctcatcaagacagctgcctt
cagagcgtacccgactgtggagtgaagggcagagaaggtcttccatcctgtggaaacaga
aacgaagtaactggaacaaactattctggagtagccacatgtcagcagccactgagcagc
aggagcagtgtgctgcaggatgccatggtcacagaaccagatgcatgccagcactcttct
ggaagggagctaccagacagctcttcaacagatgttggtgccccagaaaaggcaggggaa
ctggaacatagcctgcttaccccagatgctaccacccagaacaataagcctcaagtaggg
gaaggcacaaaggaaagacttgagaattcagacagtagcacaactgaaacaactgctgtt
caagttttaagtgaacccatggagaaagccgatattacaaaccatgtctttgccaccagt
gccgtaggtgttaacactcctgctgaggcttcacctgcattgagttctgaagaaatcccc
actgaaaaaccaggaatggaaactcaagagagaggctgtgaggggggaaccacaagtgac
cagagctccccggtgcttcctgctgctgctatagaaaacaaggttttaggtggacaagaa
cctgatacttccatagcaggcttttgtaagacagcatcacctttggatttaaccatgcca
ggcccaagttcagatgggatgccagaacagaactcagagtctcatgcacggcctgctcaa
agcctaagtggccaggcgctgctctgttctacagctgaggctggcacgccttctgctgag
gctacacatcagccgagcacagtgacttctagtggcaggttggaagaatgtggcagtggt
aaagctagcctgcctgaaagcacaatggtgcagccaagcacgcaagaactttgcaccacc
ctctgcccagaagacccacaagctgacacagtcacttctgacactgtgaaaaatacccag
aaatctgtgggggtttgtcatctctgtgtttcagatgcaaagaatcaaggaaatggtttg
aagcaagatacacctttaacgaacgtgcttgaggatgttccacgtctgccttcagttgtc
tcccagactgagaaagaactagcgccagaccaggtatcacctccagccagcagtttctct
ctggcaagcagtccagagagtgaatcagtaaccaaagatgacgcactttctcttgtcccc
tcccagaaagaaaagggaacagcaactcctcagctccatagaactacagcttgtcgagat
ggcccagatggaagagatttgagtgataccgataaggtaggagacggggccactgaccca
cctccatcctctgctgtagagcttcggaccagcatgggaaataccagccctgtaggcatt
ggtggagaacaggagggttccagcccaacagcaacacttgaagtgctgagtgactcttta
ctgcataacgtggataaagctgctttggtttctgactttactctgcctgaagaaggtgtc
agtgtagtggttccagaaagttccacagctctggggcaagatggcaaagatagagcaatg
agctgttcttcagttaaagaagacgtgcattcttcagaaatgtcaagggaagaccagaga
acacctccctctgggcaggagataccaggactctgtgaaaaacctatgtcagccctctgt
gccgaggagaaagcacagcagcacacaccctctgcctgtctgaaaacagaaactaaagac
atcaaggaagtggccccacaggtctccctgctgactgaaggtggggctgcaaagagcctg
gtgccaccaagaacgagtctgtctgccgattcaaagcagaaagcctcgagtacagagcag
agcggctcatctctgttgccaagtgggctgccaggtgcgtctgaggcactccattgtaat
cagccttctgctctcgatgttgtcgtagagaatactcagttccaaggggaaaccaatgct
tgtgaggtaagcagaagtgcgatggaggatgttacagtggctgatgcttcaccagctact
gctgagcccagaaaaaaggatgcatcacactgtatcaaagacatcccaatttcagagttg
ttaaaccaagagaagcaaatgactccaagtttgccagaagctttcctggacaaaggtgtc
actgacttacaggaagtcataaccccagagatagaaccacttgattgcaagagagagacg
ctggagggaacagaccttaactgtgccacgagtaactccaaagagaccccaatcgaaaaa
ccaatgcagcctcttgccagggacctccccacagagacagggctctcagtgatcaataac
aatgtcccccaagctgacatgaagcaagtggcacaggcttccatcccggcagaggaaagt
aatgccactactgtctcaacccaagctgcagatgtgcctaccagagcagactccatagag
gagaccgccactaggatagtggaggccgtcatcaggcaagtcagggcctccaacgcactg
atggctaaagtagaaacccagaatccgtcactctccagtccagagactaagcagctagag
aatgcttacacagagagtgcatgcgctttcctgcctggggagaccccgcagatagagaag
acgcacgaagacaccaccgggcagtgtggtgctgagacagaagaaccagagaaaattatt
ctacctgagtcagcaccaggtaagcaaggcaaaatgccagacaccagaactggagatgaa
gtggaccttctgagtaggatcagtgctgcttctgaggaggaggctgtaggaaatggagct
gccacacccaagatgaagcaaggcccggggacccaggcgatcaaccgagaaagctggtgt
gccatagagccctgccctgaagcagcatctctcttagcttccaaacagagctcagaatgc
agaagcttcatagatgttggactgggcacggagtgtgcctcaaaagaaggcatgctccag
agagtgtcagggagtgagtctgacctctttcactcacccagtgatgaaatggacagcatc
atcttcccaaagcctgaagaagagcagttactttgtgatacaacaggatccagttcttcc
acagatgacacagcttccctggatcgacattcttctcatggcagtgacgtgtcccttcct
cagacttcaaagttaaacagatccagaaatcatcaaagtgccaatggctttttcagccct
ggagtcgaggcacctgagagtcgagagagtgagagtgagcctgctggctctggtgaaatg
gaagaggaggagatggacagcatcactgaagtgcctgccaactgctcttttctgaggagc
tccatgcgttctctttctcctttccggaggcacagctggggacctgggaagaacgcagcc
agtgatgcagaaatgaaccagcggagttcaatgcgagctcttgggcatgttgtcaggaga
cctcccattcataggagaagtttcagtctggaaggcttgacaggaggaggtgttggaaat
aagccatcctcgtctctagaaatgagctctgcaaactccagcgagctcagaaaccctttc
ggtggtgaggaacagagaaactctttgatgtcactttcagaagaacatctggagccagac
cagagacagcatcataggatgtttgatcagcagacatgttacaggtctaaacaacaggga
tttaactactgtacatcagccatttcttctccattgacaaaatccatctcattaatgaca
atcagtcatcctggattggacagttcacggcccttccacagtaccagtgccaacctgacc
gagagtataacagaagaaaactgtaacttcctgcctccaagtccctcaaaaaagaatttt
gaagaaaagagtgggactaaggttagtcgcaccttcagctacatcaggaataaaatgtcc
agcagcaagaagagcaaagaaaaggaaaaggagaaggataaaattaaggagaaagagaaa
gactctaaagagaaggaaaaagataaaaagactcttaacgggcacacattcagccccatt
cctattgtgggtcccatcagctgcagccagtgcatgaagccttttaccaacaaggacgcc
tacacgtgtgcaggctgtggtgcttttgtccacaaaggctgcagagaaaatctagcctcc
tgtgcaaaggtcaaaatgaagcagccaaaagggagcctccaggcccacgatacatcatcg
ctgcccacagtcatcatgagaaacaagtcttcacagcccaaggagcgccctaggtctgca
gtcctcttggctgatgaggccactgcggcaccaatgtttactaacagacggtcccagcag
agtgtctccctctctaaaagtgtctccatacaaaacatcactggagttggcaatgatgag
aacatgtcaaacacctggaaatttctatctcattcaacagactcattgaataaaatctgc
aaggtcaatgagtcaacagaatcccttactgatgagggagtaggtacagacatgaatgaa
ggacagctgatgggagattttgaaagcgactctaaacagctagaagcagagtcatggagc
cggacagtggacagcaagttccttaaacagcagaagaaagatgtggtcaaacggcaggaa
gtgatttacgagttgatgcagacagagttacatcacatccgcacactcaagatcatgagt
gacgtgtacagccggggcatgatgacagatctgctctttgagcagcagatggtggaaaag
ctgttcccctgcttggatgagctgatcagtatccacagccagttctttcagaggatcctg
gagcggaagaaggagtctcttgtggataagagtgaaaagaactttctcatcaagaggata
ggggatgtgcttgtcagtcagttctcaggtgagagtgcagagcgcttaaagaagacatac
ggcaagttctgtggacagcacaaccagtctgtcaactacttcaaagacctctacaccaag
gataagcgtttccaagcctttgtgaagaagaagatgagcagttcagtagtaagaaggctg
ggaattccagagtgcattttacttgtaactcagaggatcaccaagtacccagttttattc
caaaggatactgcaatgtaccaaagacaatgaagtggagcaggaagacctcactcagtcc
ttgagcctggtgaaggatgtgattggagccgtggacagcaaagtggcaagttacgagaag
aaagtgcgtctcggtgagatttacacaaagacagatagcaagtcgatcatgagaatgaag
agtgggcagatgttcgccaaggaggacctaagacggaagaagctggtgcgcgacgggagt
gtgtttctgaagagcacaacaggaaggctgaaagaggttcaagcagttctactcactgac
attttagttttccttcaagaaaaagaccagaaatacgtgtttgcatccttggaccataag
tcaacagtgatctccttaaagaagctgattgtaagagaagtggcccatgaggagaaaggc
ctgttcctcatcagtatgggggtgaaagatccagagatggtggaggtccatgcaagctcc
agagaggagcggaatagctggattcagatcattcaggacacaatcaactccctgaataga
gatgaagatgaagggattcccagtgagaatgaagaagaaaagaaattgttggataccaaa
gcccgggagttaaaagaacagcttcagcagaaggaccagcagatcctcctcttgctggaa
gagaaggagatgattttccgggacatgactgagtgcagcactcccttgccagaggattgc
tccccaacgcacagcccgagagtgctcttccgctccaacacagaggaggctctcaaagga
ggaccgctgatgaaaagtgcaataaatgaagtggaaatccttcagagtttggtgagtgga
agcctcggtggcacacttggacagtccatcagcagccctgttgaacaggaagtcatggct
gcgcccatttctttgccccggagagcagagacctttggaggatttgactgtcatcagatg
aatgcttccaaaggaggtgagaaagaagagggtgatgacggccaagatctcaggagaaca
gagtcagacagcggcctgaaaaagggtggaaatggtaacctggtatttatgcttaaaaga
aacagtgagcaggttgtccagagcattgttcacctccacgaactcctcagcatgctgcag
ggtgtcgtgctacaacaagacagctacattgaggatcagaagctggtgctgacagagaag
gtcctcacaaggagtgcatctcgccccagctctctcattgagcaggagaagcagcggagc
ctggagaagcagcgccaggacctggccaacctgcagaagcagcaagcacagcacctggag
gaaaagcgccgccgggagcgtgagtgggaggcccgggagcaggagctccgagaccgagag
gccaagctggccgagcgggaagagacggtccgccgcaggcagcaggacctggagagggac
cgcgaagagctccagcagaagaagggcacttaccagtgtgacctagagaggctacgggct
gcccagaaacagctggaacgagaacaggaacagctgaggagggacacagagcggctcagc
cagaggcagatggatcagaacctttgccaggtttcaaataaacatggcaggctgatgcgg
atcccatccttcttgcccaattcggatgagttctcctcgccgtctgcaccttctgtaacc
aaatcaggctcattggactcagaactctcagtgtctcctaaaaggaacagcatctctcgg
acacagaaagataaggggcctttccatatactgggctcagccagccagacaaaagttccc
gaggggcagagccaggccccgtccagcacctccacttccacccgactctttgggttatcc
aagccaaaggaaaagaaggagaaaaagaagaagagcaaaggaagccgcacccagcctggt
gacggccctgcttcggaagtaccagcagagggtgaagagatcttctgttga

DBGET integrated database retrieval system